ライフサイエンスコーパス: human plasma

1 ly applied for aripiprazole determination in human plasma.

2 iological thiols such as glutathione) and in human plasma.

3 r genetic or iatrogenic iron overload and in human plasma.

4 ystem for the detection of EVs isolated from human plasma.

5 tein phosphorylation when compared to normal human plasma.

6 as good chemical and enzymatic stability in human plasma.

7 on of insulin-like growth factor 1 (IGF1) in human plasma.

8 on product phloroglucinol aldehyde (PGAL) in human plasma.

9 ffectively diagnoses protein C deficiency in human plasma.

10 TRX80 showed an age-dependent increase in human plasma.

11 s successfully applied to detect thrombin in human plasma.

12 e plasma mimic the metabolite composition of human plasma.

13 n molecules, and complement factors on CC in human plasma.

14 patterns within complex lipidomes including human plasma.

15 sa than the naturally-occurring AMP LL-37 in human plasma.

16 iological samples including murine brain and human plasma.

17 lity was evaluated on PLGA nanoparticles and human plasma.

18 ndogenous alpha-1-acid glycoprotein (AGP) in human plasma.

19 MS/MS bioanalysis of pasireotide (SOM230) in human plasma.

20 1-10 pg/mL PSA was also achieved in diluted human plasma.

21 ction of prostate cancer (PCa) biomarkers in human plasma.

22 their ability to neutralize FVIII in normal human plasma.

23 l provided excellent stability in monkey and human plasma.

24 he target DNA in the hybridization buffer or human plasma.

25 de metabolite, BMS-801576, concentrations in human plasma.

26 sease-relevant platelet aggregation assay in human plasma.

27 -induced complement activation in autologous human plasma.

28 /MS) bioanalytical assay of dapagliflozin in human plasma.

29 key soluble complement-regulating protein in human plasma.

30 o 50 femtogram of PFCs, in one microliter of human plasma.

31 ied for selective extraction of quinine from human plasma.

32 to generate different coagulation times for human plasma.

33 This approach was further investigated from human plasma.

34 were within quantification range in control human plasma.

35 of unconjugated fatty acids (FA) in fish and human plasma.

36 ct human insulin and five insulin analogs in human plasma.

37 ococcal agglutination with fibrin fibrils in human plasma.

38 successfully applied to real samples such as human plasma.

39 presence had not been previously observed in human plasma.

40 ndard Reference Material 1950 Metabolites in Human Plasma.

41 .6 muIU/mL) for each insulin from 250 muL of human plasma.

42 f its low solubility and fast clearance from human plasma.

43 isely measure the length of CMV fragments in human plasma.

44 's posttranslational modification in L5 from human plasma.

45 ration of biotin in mouse plasma compared to human plasma.

46 Y, NPY2-36, NPY3-36, NPY1-35, and NPY3-35 in human plasma.

47 a Cu-based metal-organic framework (MOF) in human plasma.

48 d by MS the material pulled down by VC1 from human plasma.

49 vant concentrations (73.26 fM) of ctDNA from human plasma.

50 act [Pyr(1)]apelin-13 and its metabolites in human plasma.

51 ) and diacylglycerol (DG) lipid species from human plasma.

52 xDMS-MS separation of sulfonamide isomers in human plasma.

53 rtantly, the conjugates formed are stable in human plasma.

54 nopore chip, and (3) deploying the sensor in human plasma.

55 fibrinogen from FXIII-A-deficient mouse and human plasmas.

56 ed partial thromboplastin time of baboon and human plasmas.

57 dC concentrations present in murine, but not human, plasma.

58 In human plasma, 30-40% of PCSK9 is bound to LDL particles;

59 l for evaluating the antioxidant capacity of human plasma after acute intake of tea.

60 Material (SRM) 1950, "Metabolites in Frozen Human Plasma", against benchmark consensus mean concentr

61 Interestingly, human plasma AKG level is also negatively correlated wit

62 stable in vitro in FBS, BALB/c-nu plasma and human plasma, although release of the drug at HT was inc

63 a limit of detection of 0.28 U/ml heparin in human plasma and 0.29 U/ml in whole blood with a linear

64 says, we compared the properties of DENVs in human plasma and after one passage on laboratory cell li

65 n is the Hb binding and clearance protein in human plasma and an efficient antagonist of Hb toxicity

66 In addition, both BMP10 in human plasma and BMP10 secreted from the mouse right atr

67 Human plasma and cell culture-derived virions had identi

68 -A and fibroblast growth factor-2 (FGF-2) in human plasma and colocalizes with VEGF-A in ECs.

69 all analogs were calculated in 6 sources of human plasma and CVs of the matrix factors were <15% in

70 HRMS assay was fit-for-purpose validated in human plasma and demonstrated good linearity, accuracy,

71 Both (R)-9b and (S)-9b were stable in human plasma and displayed a long half-life (t(1/2) > 6

72 tests, we find SSTNIGF1R is highly stable in human plasma and displays a half-life of 27 hours in mic

73 ACE2) on peptide metabolism was evaluated in human plasma and explanted heart tissue from patients wi

74 n quantification in buffer, human serum, and human plasma and for assaying hormone secretions from en

75 Metabolomics analyses of human plasma and HaCaT cells were used to compare the ab

76 a high-molecular-weight leptin complex from human plasma and identified clusterin as a major compone

77 reciprocal activation of PK and deltaFXII in human plasma and in mice appears to overwhelm the normal

78 eased the biologically active C5a peptide in human plasma and induced migration of neutrophils.

79 ze the M1-associated protein interactions in human plasma and investigate the acquisition of proteins

80 pre-existing antibodies against SAgs in many human plasma and IVIG samples and demonstrate that in a

81 cells were treated with Lp(a) purified from human plasma and Lp(a) uptake studied using Western blot

82 cells were treated with Lp(a) purified from human plasma and Lp(a) uptake studied using Western blot

83 /59 fragment was identified post-MI, both in human plasma and mouse LV, at levels that inversely corr

84 validated our assay performance using pooled human plasma and NIST SRM 1950 samples.

85 n G protein-coupled receptor (GPCR) GPR56 in human plasma and report that GPR56 is the platelet recep

86 -to-antibody ratio of 2, which was stable in human plasma and retained its specificity towards Her2+

87 es the calculation of the GSH:GSSG ratios in human plasma and saliva samples.

88 The specimens included human plasma and serum from male and female donors, mous

89 mino acids and amino-containing compounds in human plasma and serum using precolumn derivatization wi

90 tivation in normal, as opposed to deficient, human plasma and serum.

91 uantification of lowly expressed miRNAs from human plasma and tissue derived RNA, and obviates the ne

92 all-trans geometric isomer in foods, whereas human plasma and tissues show greater proportions of cis

93 Shed sTim-3 was found in human plasma and was significantly elevated during early

94 IgG4) directly in unfractionated samples of human plasma and we detect traces of previously unreport

95 rapidly hydrolyzed in rat plasma but not in human plasma and were stable in simulated gastrointestin

96 tion of the thrombin inhibitor dabigatran in human plasma and whole blood samples, highlighting its p

97 groups in two representative samples (i.e., human plasma and yeast).

98 of naturally occurring anti-influenza Abs in human plasma, and did not differ between HCMV(+) and HCM

99 nal after 1 month of exposure to unprocessed human plasma, and functionalization with specific antibo

100 essful detect P. aeruginosa and S. aureus in human plasma, and is very useful for the diagnosis of ba

101 trovafloxacin at drug concentrations seen in human plasma, and its inhibition led to dysregulated fra

102 e drug from the proteins that are present in human plasma, and some of the peptides are capable of di

103 uch as hyperimmune globulin and convalescent human plasma, and to developing vaccines, antivirals, an

104 method for selected betainized compounds in human plasma, and to investigate their association with

105 onic metabolite mixture in water, pretreated human plasma, and urine samples spiked with the same met

106 e tested on common samples for metabolomics, human plasma, and urine.

107 is used to quantify lipids in NIST SRM 1950 human plasma annotated using LipidMatch and MZmine.

108 ose minor alleles are associated with higher human plasma ANP levels.

109 red cabbage anthocyanins bioavailability and human plasma antioxidant capacity.

110 rest because high levels of this molecule in human plasma are associated with an increasing risk of c

111 MA involved tri-enzyme extraction including human plasma as a deconjugase.

112 engineered library is structurally stable in human plasma as well as being hemocompatible (non-hemoly

113 zymatic release of payload from ADC-depleted human plasma at 144 h was able to account for almost 100

114 plasma clearance in mice, occurs sparsely in human plasma (at one fortieth of the FH concentration),

115 centrations routinely achieved clinically in human plasma, atovaquone inhibits STAT3 phosphorylation,

116 mbers of diverse RNA virus families within a human plasma background, some present at very low levels

117 drug (levothyroxine) and its metabolites in human plasma, based on precolumn derivatization followed

118 ino)hexanoate (13d), was stable in swine and human plasma but liberated 14 in swine brain homogenate.

119 or selected nanosized biomacromolecules from human plasma by on-line coupled immunoaffinity chromatog

120 precursor cells (CSPG4Es) were purified from human plasma by sequential immunoabsorption with anti-CS

121 stidine-rich glycoprotein (HRG) in mouse and human plasma by size-exclusion chromatography.

122 ydroglucitol, a compound normally present in human plasma, by side activities of ADP-glucokinase and

123 proach to investigate the entire spectrum of human plasma cell neoplasia and illustrate the utility o

124 recapitulates the systemic manifestations of human plasma cell neoplasms, and implicates cooperativit

125 Long-lived human plasma cells (PCs) play central roles in immunity

126 The anti-FcRH5/CD3 TDB kills human plasma cells and patient-derived myeloma cells at

127 ight-chain production and cause apoptosis in human plasma cells making intact IgGlambda antibodies.

128 mbda-light-chain production and secretion by human plasma cells regardless of sequence diversity.

129 cal memory based upon intrinsic longevity of human plasma cells.

130 Moreover, they are effective inhibitors of human plasma clotting in vitro.

131 established for purified blood proteases or human plasma clotting isotropically.

132 stability in the presence of RNase A and in human plasma, comparatively more stable than DNA is demo

133 ibrin hydrogel nucleation and growth at near human plasma concentrations of fibrinogen.

134 Human plasma contains > 40,000 different coding and non-

135 We confirmed that human plasma contains immunoglobulins that can neutraliz

136 g previous TGIRT-seq analysis, we found that human plasma contains largely fragmented mRNAs from > 19

137 s purified from either conditioned medium or human plasma could partially rescue the defects of HSCs

138 aurine (C18:1 NAT), the most abundant NAT in human plasma, decreases food intake, improves glucose to

139 inhibition and to undergo cleavage in rat or human plasma depending on the NSAID portion.

140 we demonstrate the detection of TNFalpha in human-plasma derived samples as an example for point-of-

141 In our previous study, we reported that human plasma-derived exosomes contain substantial level

142 Human-plasma-derived immune globulin (IG) is used in aug

143 We initially optimized human plasma digestion and extraction conditions for max

144 y detects EBOV soluble glycoprotein (sGP) in human plasma down to 220 fg mL(-1) , a significant 240 0

145 Altered cargo proteins of human plasma endothelial cell-derived exosomes in athero

146 etary CAF achieving blood levels measured in human plasma exacerbates the penetrance of RYR1 MH susce

147 47 Da over the native albumin extracted from human plasma, exactly matching the mass of the linker-pa

148 etabolizing cytochrome P450 (CYP) enzymes in human plasma exosomes are yet to be explored.

149 RNAs with varied 5' and 3' ends, as well as human plasma exRNA Analyzing phospho-RNA-seq data using

150 xample of the quantitation of daclatasvir in human plasma extracted with liquid-liquid extraction.

151 In human plasma, F5 and G2 prolonged clot lysis time from 9

152 ed ZT(Fn) , is presented that closely mimics human plasma fibronectin and serves as an economical, xe

153 vascular endothelial growth factor (VEGF) in human plasma for cancer diagnosis.

154 olar activity toward HIV-1 and are stable in human plasma for more than 24 h with a therapeutic index

155 tigation of the changes in the metabolome in human plasma for patients with injury to their anterior

156 uality control samples, reference plasma and human plasma from a real nutrimetabolomic study were use

157 oring of the glucose and L-lactate levels in human plasma from patients with diabetes is demonstrated

158 r the determination of l-tyrosine (l-Tyr) in human plasma from tyrosinemia-diagnosed patients.

159 Spike-in experiments in human plasma further encouraged assay application on cli

160 Recombinant human plasma gelsolin (rhu-pGSN), a normally circulating

161 In addition, human plasma had a neutralizing effect on cytotoxicity o

162 he mass of the major protein in ADC-depleted human plasma had an additional 1347 Da over the native a

163 high plasma protein binding abilities and a human plasma half-life of 160 min, resulting in formatio

164 This is the first time that oxidized AGT in human plasma has been linked directly to antioxidant sta

165 ze and composition, isolated subfractions of human plasma HDL, cell lines stably expressing ABCA1 or

166 bolite concentrations comparable to those of human plasma (human plasma-like medium [HPLM]).

167 In humans, plasma hyperosmolality delays the onset of sweat

168 Application of this online platform to human plasma identified 376 glycated peptides from 10 mu

169 stones H3 and H4 triggered TG in recalcified human plasma in a platelet-dependent manner.

170 at canagliflozin concentrations measured in human plasma in clinical trials and was caused by inhibi

171 potassium were also determined in undiluted human plasma in the therapeutic concentration range.

172 Several splice variants of IgE exist in human plasma, including a variant called IgE-tailpiece (

173 enescence that overlap with aging markers in human plasma, including Growth/differentiation factor 15

174 the analysis of targeted GPLs extracted from human plasma, including several proposed plasma biomarke

175 ted peptides quantified in in vitro glycated human plasma increased more than 3-fold using this platf

176 untreated or hTNFalpha-treated PAEC with 10% human plasma induced complement C3b/c and C5b-9 depositi

177 C with CHC (100 microg/ml) protected against human plasma-induced endothelial activation and damage.

178 The use of convalescent-phase human plasma is an effective treatment in humans infecte

179 Using TWIMS in biomarker discovery in human plasma is thus recommended.

180 is the first study to characterize sTim-3 in human plasma, its source, and mechanism of production.

181 In humans, plasma KIM-1 levels were higher in patients with

182 rations comparable to those of human plasma (human plasma-like medium [HPLM]).

183 te concentrations within even 2-fold diluted human plasma may be determined reliably using as few as

184 ratio of metabolites in animal plasma versus human plasma measured over approximately 1 year apart we

185 This prodrug is stable in acid and human plasma media, but it is efficiently processed in h

186 small molecule standards and, separately, on human plasma metabolite extracts.

187 cally important differences in water soluble human plasma metabolome.

188 g the glycosylation of a cancer biomarker in human plasma, MUC5AC, using only 20 muL of the plasma.

189 Analysis of the human plasma N-glycome allowed high-throughput detection

190 ontaining mixtures such as PNGase F-released human plasma N-glycome.

191 The capacity to isolate immunochemically human plasma neuron-derived exosomes (NDEs), containing

192 onversely, when strain PC574 was cultured in human plasma, no similar increase in hemolytic activity

193 ittle as 1 PFU of ZIKV in 100 mul of saline, human plasma, or human urine.

194 he parental strain in growth in human serum, human plasma, or sheep or horse blood.

195 In human plasma, osmotic shock increased cBIN1 detection by

196 Cargo proteins of human plasma platelet-derived exosomes may biomark plate

197 Human plasma platelet-derived exosomes: effects of aspir

198 ofile all RNA biotypes in apheresis-prepared human plasma pooled from healthy individuals.

199 ry program increased the fraction unbound to human plasma protein from below minimum detection levels

200 exploited to improve the fraction unbound to human plasma protein while retaining biochemical potency

201 nt on ASO interactions with several abundant human plasma proteins and determined the effect of salt

202 liposomes with an artificial corona made of human plasma proteins drastically reduces capture by cir

203 Treatment with the naturally occurring human plasma proteins haptoglobin or hemopexin may have

204 gh surface area and high pore volume towards human plasma proteins has been investigated.

205 test of our new technique, we have levitated human plasma proteins using MagLev.

206 d binding constants for the 25 most abundant human plasma proteins with phosphorothioate (PS) modifie

207 can change the thermal behavior of specific human plasma proteins, leading to an elevation of the he

208 Here, we present a method for in-depth human plasma proteome analysis based on high-resolution

209 We demonstrate that the human plasma proteome is responsive to acute exercise in

210 mple-processing pipeline for analysis of the human plasma proteome that provides greatly increased de

211 covered marked non-linear alterations in the human plasma proteome with age.

212 Compared to the comprehensive human plasma proteome, 5 of 11 serum proteins had a diff

213 le of exercise and exercise intensity on the human plasma proteome.

214 Large-scale human plasma proteomics, cross-referenced to unbiased ca

215 This preliminary report of human plasma provides a basis for future studies investi

216 cofactor II (HCII), a key serpin present in human plasma, remain unknown.

217 g factors or whether such activity exists in human plasma remains unknown.

218 etection (LOD) of 26 and 81 fM in buffer and human plasma, respectively, confirming the practical app

219 xidized low-density lipoproteins (OxLDL) and human plasma, respectively, their analysis as risk bioma

220 that better recapitulates the composition of human plasma reveals unforeseen metabolic wiring and reg

221 nsive profiling of whole-cell, exosomal, and human plasma RNAs; quantitative tRNA-seq based on the ab

222 m gel electrophoresis of an albumin-depleted human plasma sample were excised for in-gel MAAH LC-MS a

223 and active enzyme) from 70 muLpost-exposure human plasma sample.

224 cal application for methylation detection in human plasma sample.

225 immunoglobulin G and/or immunoglobulin M in human plasma samples after treatment.

226 To this end, we used 126 identical human plasma samples and 29 quality control samples from

227 linical trial, the sensor detects sGP-spiked human plasma samples at two times the limit of detection

228 ore, we demonstrated that target DNA in real human plasma samples can be directly amplified and detec

229 In comparison, only 2 out of 42 (5%) human plasma samples collected in a similar time frame o

230 ments found that DNA isolated from identical human plasma samples displayed plate edge effects result

231 ssful capture of a 120 bp KRAS fragment from human plasma samples followed by real-time quantitative

232 ical detection of the anesthetic propofol in human plasma samples for clinical diagnoses.

233 m of this study was to quantify oxylipins in human plasma samples from an intervention study in which

234 cation of the proposed method to measure 124 human plasma samples from orchard workers and cotton far

235 , IdeS reduced anti-AAV antibody levels from human plasma samples in vitro, including plasma from pro

236 selective immune response against PfGARP in human plasma samples obtained from patients in rural Mal

237 hroughput glycomic analysis to banked HIV(+) human plasma samples to determine whether the glycome ma

238 Analysis of 71 human plasma samples uncovered a strong correlation betw

239 urface (MAPS), for measuring MPO activity in human plasma samples using the bioluminescent substrate

240 dard deviations (RSD) between the cycles for human plasma samples were 0.84-6.6%.

241 To evaluate these models, human plasma samples were analyzed by LC-HRMS on an Orbi

242 values determined for the two analytes in 35 human plasma samples were in excellent agreement with th

243 Two types of human plasma samples were split into two batches and ana

244 roach can remove 95% of the total albumin in human plasma samples while retaining close to 100% for t

245 ons of 75 compounds previously identified in human plasma samples with annotations generated by three

246 bled the selective Se speciation analysis of human plasma samples without the need of extensive clean

247 In 330 human plasma samples, a positive association between amy

248 asured human cardiac troponin I protein in 9 human plasma samples, and showed excellent agreement wit

249 We demonstrated that, as for human plasma samples, ASAP(2) is efficient in analyzing

250 In human plasma samples, we demonstrate that blocking of hi

251 ics data set derived from approximately 3000 human plasma samples, we find that application of our al

252 of the total enzyme amount in post-exposure human plasma samples.

253 g and smoking-related biomarker discovery in human plasma samples.

254 der different experimental conditions and of human plasma samples.

255 ion and sensing of propofol molecules in the human plasma samples.

256 mouse tissues, nonhuman primate tissues, and human plasma samples.

257 at can recognize thrombospondin-1 protein in human plasma samples.

258 A profiles from a longitudinal collection of human plasma samples.

259 form for measuring the total amount of OT in human plasma/serum.

260 The human plasma site-specific glycan map described herein h

261 Starting with human plasma spiked with whole, live E. coli cells, this

262 Tolcapone binds specifically to TTR in human plasma, stabilizes the native tetramer in vivo in

263 mination of five different drugs spiked into human plasma, synthetic urine (SU), and artificial cereb

264 rough metabolomic and lipidomic profiling of human plasma taken from 198 human participants before an

265 lity in terms of biological sample analysis (human plasma), temporal stability, and reusability was a

266 ound significantly higher amounts of Vn from human plasma than did an isdB mutant.

267 d glycoproteins in EVs from small volumes of human plasma that enabled us to identify nearly 10,000 u

268 /gL complex were the principal components in human plasma that neutralized infection of epithelial ce

269 We recently identified 156 proteins in human plasma that were each associated with the net Fram

270 m (mainly glucuronide) of quercetin found in human plasma, the pharmacokinetics results have demonstr

271 cific modification of endogenous fetuin A in human plasma, the synthesis of tandem fluorophore-protei

272 Together with an increased lifetime in human plasma, the thermostable GeoCas9 provides the foun

273 y achieves the required sensitivity range in human plasma to allow reliable differentiation between h

274 Moreover, addition of human plasma to the culture in FBS appeared to inhibit t

275 lbumin-AalphaC adducts were characterized in human plasma treated with N-oxidized metabolites of Aalp

276 /= 24 hours on biomaterials conditioned with human plasma under venous shear in iron-free cell cultur

277 alpha1-Antitrypsin (A1AT) purified from human plasma upregulates expression and release of angio

278 limpse of the antibody diversity inherent in human plasma used to manufacture IG products..

279 ation of empagliflozin (25-600 ng mL(-1)) in human plasma using dapagliflozin as an internal standard

280 lly extracted from physiological buffers and human plasma using the increased porosity coating, while

281 es PKal activity in vitro in both murine and human plasma, via a factor XII (FXII)-dependent mechanis

282 y for the standard curve points in extracted human plasma was 99-100%.

283 for quantitative analysis of pasireotide in human plasma was evaluated and compared to those obtaine

284 Quantitative detection of MMP-7 in human plasma was further demonstrated with a LOD of 40 n

285 The sequence of the peptide isolated from human plasma was HSGFEDELSEVLENQSSQAELKEAVEEPSSKDVME.

286 Human plasma was incubated with the OP dichlorvos that w

287 cells in FBS, and a higher concentration of human plasma was necessary to reduce the cytotoxicity of

288 The results were also reproducible when the human plasma was present in our assay system.

289 post-prandial absorption of sapotexanthin to human plasma was proven for the first time.

290 Human plasma was spiked with pasireotide with concentrat

291 The direct detection of sunitinib in human plasma was successfully demonstrated by fluorescen

292 The in vitro analysis of potassium in human plasma was successfully demonstrated with this app

293 thods for the profiling of micronutrients in human plasma, we introduce a novel, validated workflow f

294 lasma proteins capable of binding PS ASOs in human plasma were confirmed by employing affinity chroma

295 When nanoworms pre-coated with human plasma were injected into mice, C3 and other adsor

296 terminations of NO2(-) and NO3(-) present in human plasma, whole blood and saliva samples.

297 port on reagentless cholesterol detection in human plasma with a novel single-enzyme, membrane-free,

298 ive analysis of the drug enalapril in pooled human plasma with ramipril as an internal standard, a gr

299 the measurement of thrombin added to healthy human plasma with same high sensitivity and a limit of d

300 eous detection of both antibiotics in spiked human plasma within a sample-to-result time of less than