ライフサイエンスコーパス: oligopeptide

1 nificantly reduced by a small JPH2-mimicking oligopeptide.

2 ly because of the presence of R and D in the oligopeptide.

3 nitiation at AUG872, yielding a proline-rich oligopeptide.

4 rmation of histidine (His) in His-containing oligopeptides.

5 ively liberate most dipeptides from nutrient oligopeptides.

6 iles show the full potential of the employed oligopeptides.

7 ino acids, and water-soluble X5 and X10 homo-oligopeptides.

8 stematically evaluated for a series of model oligopeptides.

9 for modelling the ACE inhibition activity of oligopeptides.

10 on products such as glycine and glycine-rich oligopeptides.

11 generated T cells against several cyclin-A1 oligopeptides.

12 ufficient to promote proton uptake for these oligopeptides.

13 a, lacked antibodies recognizing linear LcrV oligopeptides.

14 ic, yet tight, seal around the translocating oligopeptides.

15 ration of dipeptides from hemoglobin-derived oligopeptides.

16 ode PatS C-terminal 4 (GSGR) to 8 (CDERGSGR) oligopeptides.

17 of rapamycin with a combinatorial library of oligopeptides.

18 en expressed in bacteria, TbGPR89 transports oligopeptides.

19 (TAAC) polymerization to 1,4-triazole-linked oligopeptides.

20 synthesis by blocking the passage of nascent oligopeptides.

21 permeable to amino acids yet impermeable to oligopeptides.

22 mass spectrometric analyses of the generated oligopeptides.

23 a mesh-like network comprised of sugars and oligopeptides.

24 A pyrene-functionalized cationic oligopeptide 1 efficiently binds to double-stranded DNA,

25 The eight-residue alanine oligopeptide Ac-A(4)KA(2)Y-NH(2) (AKY8) was found to for

26 RagAB as a dynamic, selective outer-membrane oligopeptide-acquisition machine that is essential for t

27 of the DeltadacA mutant we hypothesized that oligopeptides act as osmolytes, similar to glycine betai

28 The oligonucleotide-oligopeptide adducts are heat stable but are partially r

29 upon addition of LiCl to reduce polymer and oligopeptide aggregation.

30 e: 1) proteolytic resistance compared to the oligopeptide alone; 2) significantly enhanced cell uptak

31 netrating peptides promoted Cre delivery but oligopeptides alone or oligopeptides displayed on nanopa

32 enging amino acids, nucleotides, and complex oligopeptides, along with lithotrophic capacity on thios

33 with Michalis-Menten kinetic analyses of 21 oligopeptide aminomethyl-coumarin substrates.

34 pA, two periplasmic binding proteins for the oligopeptide and dipeptide transport systems.

35 duced proteolytic activities in Tsh-specific oligopeptide and mucin cleavage assays.

36 their possession of a higher total amount of oligopeptides and a lower ratio of vicilin to 21kDa coco

37 s off tripeptides from the free N termini of oligopeptides and also shows minor endopeptidase activit

38 ulated molecular structures of the metalated oligopeptides and duplexes indicate that the peptide bac

39 s sense population density-specific secreted oligopeptides and modulate the expression of genes invol

40 uctures for more than 40 different proteins, oligopeptides and organic molecules have been determined

41 For nonspecific binding of oligopeptides and other cationic ligands, including prot

42 that PIs altered the degradation patterns of oligopeptides and peptide production in a sequence-speci

43 ironments where AAs in combined forms (e.g., oligopeptides and proteins) are more abundant than free

44 from oligopeptides when proteases cleave the oligopeptides and release amino acids.

45 systems considered are a large DNA fragment, oligopeptides, and even entire proteins in an implicit s

46 drophobic, neutral, cationic, anionic, short oligopeptides, and long polypeptides.

47 er identical conditions, XGo produced larger oligopeptides, and XGh produced smaller peptides, as evi

48 A single amino acid and various oligopeptides are grafted with yields up to 60% after a

49 This study demonstrates that oligopeptides are important Maillard flavor precursors.

50 Oligopeptides are important markers of protein metabolis

51 se inhibitors (PIs) and structurally related oligopeptides are known to reversibly bind and inactivat

52 Oligopeptides are robust substrates for the selective re

53 develop a neonicotinoid biosensor, these two oligopeptides are synthesized and immobilized on the sur

54 In this study, oligopeptide arrays were used to screen substrates direc

55 ce for alpha-helix formation of a 10-alanine oligopeptide as a function of its position within the tr

56 ce enzyme-labeled antibodies, we use a short oligopeptide as an hCG receptor to bind hCG.

57 ng flavourzyme which was mainly consisted of oligopeptides as the main fraction as well as small frac

58 ripeptides, mimosine-FFY, and short-sequence oligopeptides at inhibiting mushroom tyrosinase.

59 P) is a large 80 kDa protease, which cleaves oligopeptides at the C-terminal side of proline residues

60 RapJ in complex with the centrally important oligopeptide autoinducer competence and sporulation fact

61 PrgX proteins that are regulated by imported oligopeptide autoinducers.

62 ead-to-tail cyclodimerization of resin-bound oligopeptides bearing azide and alkyne groups occurs rea

63 Oligopeptides bearing internal diacetylene units are sho

64 ight-binding oligosaccharide/oligonucleotide/oligopeptide binding (OB)-fold.

65 Of these, a transcript encoding a putative oligopeptide binding protein (OppA) was further characte

66 d oligopeptide permease protein A (OppA), an oligopeptide binding protein of an apparent oligopeptide

67 g-law polyelectrolyte theory for +4 cationic oligopeptides binding to single-stranded nucleic acids.

68 ce of an OB (oligonucleotide/oligosaccharide/oligopeptide) binding motif to recognize single-stranded

69 er surface lipoprotein OspA, the periplasmic oligopeptide-binding lipoprotein OppAIV and mRFP1, a mon

70 ntypeable Haemophilus influenzae (NTHi), the oligopeptide-binding protein (OppA) serves as the substr

71 Comparison of PrgZ with homologous oligopeptide-binding proteins (AppA and OppA) explains t

72 ins in addition to dentilisin, most notably, oligopeptide-binding proteins (OBPs) and the beta-barrel

73 By contrast, oligopeptide-binding proteins bind their ligands through

74 nding protein (tm0031) that is homologous to oligopeptide-binding proteins.

75 zeta (PKC-zeta) inhibitor (a pseudosubstrate oligopeptide), but not a PKC-alphabeta inhibitor, signif

76 hemically crosslinked to cysteine-containing oligopeptides by low doses of UVA.

77 RU, also known as CROPS [combined repetitive oligopeptides]) C-terminal region, was shown to elicit p

78 This oligopeptide can be cleaved by alpha-chymotrypsin at mul

79 he VCD signal intensities of amino acids and oligopeptides can be enhanced by up to 2 orders of magni

80 sugars using light as external stimulus and oligopeptide catalysts equipped with an azobenzene moiet

81 ilized on a solid surface, its long flexible oligopeptide chain is able to influence the orientation

82 ydration condensation of amino acids forming oligopeptide chains in around 50% yield.

83 The ATS-9R/shFABP4 oligopeptide complex could prove to be a safe therapeuti

84 his culture filtrate was identified to be an oligopeptide composed of 11 amino acids.

85 olysis of cross-linked proteins into smaller oligopeptides constitutes an initial step in removal of

86 An end-linked oligopeptide containing one or more cysteines promoted P

87 ding of Fab 1A5 to DENV-2 was competed by an oligopeptide containing the fusion peptide sequence as s

88 ific AQP4 binding of a fluorescently labeled oligopeptide containing the putative adhesion sequence i

89 is for GLUT4 inhibition, a family of related oligopeptides containing structural elements found in PI

90 Oligopeptides containing the same amino acid substitutio

91 caques consistently reacted with overlapping oligopeptides corresponding to a region located within t

92 ic parameters determined for the cleavage of oligopeptides corresponding to the cleavage sites in r-p

93 en cellular receptors and synthetic adhesion oligopeptides coupled to an artificial extracellular mat

94 ons form interstrand cross-links between two oligopeptides, creating duplex structures linked exclusi

95 is not known whether the combined repetitive oligopeptide (CROP) domain is involved in or required fo

96 epitopes within the TcdB combined repetitive oligopeptide (CROP) domain, preventing toxin binding to

97 least in part via their combined repetitive oligopeptide (CROP) domains.

98 y a C-terminal domain of combined repetitive oligopeptides (CROP).

99 gest that the C-terminal combined repetitive oligopeptides (CROPs) domain of TcdB is dynamic and can

100 at pH 7.4) in which the combined repetitive oligopeptides (CROPS) domain points away from the delive

101 s a carbohydrate-binding combined repetitive oligopeptides (CROPs) domain that mediates its attachmen

102 s on the TcdA C-terminal combined repetitive oligopeptides (CROPs) domain.

103 However, 4- and 12-aa-long oligopeptides crosslinked to the DNA backbone were recog

104 Multiple copies of a short oligopeptide derived from a minimal transactivation doma

105 istocompatibility complex (MHC) that present oligopeptides derived from aberrant self or foreign prot

106 ad specificity of the Mtb proteasome towards oligopeptides described in the companion article.

107 This oligopeptide did not interfere significantly with viral

108 oted Cre delivery but oligopeptides alone or oligopeptides displayed on nanoparticles did not.

109 ANXA1-based oligopeptides displayed the same effects as ANXA1 on NF-

110 of recognition and repair of protein-DNA and oligopeptide-DNA crosslinks by the human excision nuclea

111 '2A' oligopeptides drive one such event, termed 'stop-carry o

112 ammetry of the Fe(2+)- and Cu(2+)-linked bpy oligopeptide duplexes shows that they possess unique ele

113 gnificantly modulated the photoreactivity of oligopeptides either through altering the accessibility

114 The oligopeptide epitope tags allow the affinity purificatio

115 ogels modified with a colon cancer-targeting oligopeptide exhibited up to a 324% enhancement in co-lo

116 -aminoisobutyric acid (Aib) in alanine-based oligopeptides favors the formation of a 3(10) helix when

117 The aqueous self-assembly of oligopeptide-flanked pi-conjugated molecules into discre

118 arding the de novo design of self-assembling oligopeptides for biomedical and biotechnological applic

119 transporter to facilitate the acquisition of oligopeptides for growth while simultaneously reducing t

120 he development of cocoa aroma, however cocoa oligopeptide fraction is under-investigated.

121 In contrast, when the shorter oligopeptide fragments are immobilized on the same surfa

122 Isolated oligopeptide fragments containing this epitope act as fu

123 mino acids de novo and therefore must obtain oligopeptides from its host cell for growth.

124 nd determines the prevalent folding of small oligopeptides (from di- to tetramers) composed of 2-amin

125 This oligopeptide functionalized SPR biosensor also shows goo

126 This oligopeptide functionalized SPR biosensor can rapidly de

127 The sensitivity of this oligopeptide-functionalized SPR biosensor is 1.02 RU/muM

128 n of the corresponding gene, proved that the oligopeptide functioned as an autoregulatory molecule re

129 , we show that an adipocyte-targeting fusion-oligopeptide gene carrier consisting of an adipocyte-tar

130 molecules are derived mainly from cytosolic oligopeptides generated by proteasomes during the degrad

131 rile necrosis relies on proteasome-dependent oligopeptide generation and functional status of peptida

132 The present SAR of those CXCL12-oligopeptide grafts reveals the key determinants involve

133 Long oligopeptides (>10 residues) are generated during the ca

134 crystallographic coordinates of LacY and the oligopeptide/H(+) symporter.

135 The presence of oligopeptides had an enhancing role on the generation of

136 nitrogen in the form of free amino acids and oligopeptides has received increasing attention over the

137 Two oligopeptides, hepta-histidine (7H) and Angiotensin III,

138 his study, loss of function mutations in the oligopeptide importer (oppABCDF) and glycine betaine imp

139 the sorption-enhanced phototransformation of oligopeptides in solutions containing chromophoric disso

140 form a deep investigation of the presence of oligopeptides in unfermented, under fermented, and well-

141 20 nM were obtained for biologically active oligopeptides in water.

142 de binding motif of pepstatin A, a microbial oligopeptide inhibitor, in the CatD active site.

143 Oligopeptides inspired by the antifreeze protein (AFP) a

144 t model for the catabolism of globin-derived oligopeptides invokes peptide transport out of the food

145 tion of a 3(10) helix when the length of the oligopeptide is about four to six residues.

146 Finally, conjugation of the glycan to PSMA oligopeptide is described.

147 The 2A oligopeptide is emerging as a highly effective new tool

148 When the original oligopeptide is immobilized on a solid surface, its long

149 l differential ln a(+/-)) for binding of the oligopeptide KWK6 (ZL = +8) to single-stranded (ss) dT(p

150 nding density) for the +8-charged C-amidated oligopeptide KWK6 and short single-stranded DNA oligonuc

151 ons for any protein that recognizes specific oligopeptide ligands.

152 ented proteolysis of hemoglobin (Hb)-derived oligopeptides, likely starving the parasite resulting in

153 The latter employs an oligopeptide-linked GFPc that functions as both a surfac

154 IgE-binding epitopes were identified by oligopeptide microarray.

155 used for grafting poly(ethylene glycol) and oligopeptide moieties by the Cu(I)-catalyzed addition of

156 In order to diversify the structure of the oligopeptide moiety of the muraymycins for thorough stru

157 This one-pot protocol utilizes an oligopeptide multicatalyst, m-CPBA as the oxidant, and N

158 Of the oligopeptide mutants, only the oppB strain differed sign

159 Formation of aligned synthetic oligopeptide nanostructures is accomplished using planar

160 pen-gate Mtb mutant 750 kDa particle cleaved oligopeptides not only after hydrophobic residues but al

161 proteolytic digestion of hemoglobin to short oligopeptides occurs in an acidic organelle called the f

162 In contrast, short oligopeptides of acidic amino acids were found to locali

163 by ROMP and be of general use with norbornyl oligopeptides of any sequence.

164 catalyst is functional for the synthesis of oligopeptides on solid phase.

165 ansporter genes for dipeptide (dppABCDF) and oligopeptide (oppABCD) transport.

166 The oligopeptide permease (opp) ABC transport system is a nu

167 The B. burgdorferi oligopeptide permease (Opp) is one of only a few transpo

168 orthologues of the substrate binding protein oligopeptide permease A (OppA).

169 ons is one of the five annotated homologs of oligopeptide permease A (OppA5, BBA34).

170 M. catarrhalis has a putative oligopeptide permease ABC transport operon (opp) consist

171 xpression is polycistronic with the upstream oligopeptide permease genes (opp1ABCDF), which encode an

172 ing approach for vaccine antigens identified oligopeptide permease protein A (OppA), an oligopeptide

173 hed transformability, as did deletion of the oligopeptide permease subunit oppD, suggesting that XIP

174 encodes an arginine deiminase pathway and an oligopeptide permease system that could contribute to gr

175 The opp operon, which encodes an oligopeptide permease that is essential for sporulation

176 ly controlled by ScoC and encodes a putative oligopeptide permease, was activated indirectly by CodY

177 ntracellular receptor, ComR, after uptake by oligopeptide permease.

178 large mechanosensitive channel, or Opp, the oligopeptide permease.

179 e family, a dipeptide permease (Dpp) and two oligopeptide permeases (Opp and App) with overlapping sp

180 e, we investigated the role of two conserved oligopeptide permeases, Opp and App, in the regulation o

181 for the synthesis and modification of novel oligopeptide-pharmacophore conjugates by C-H functionali

182 Different oligopeptides, phenolic acids and flavonols were identif

183 owires prepared from perylene bisimides with oligopeptide-polymer side chains.

184 ngth (n = 25-50) of high-substituent-density oligopeptide polymers synthesized by ROMP is dramaticall

185 s of oligonucleotides, oligosaccharides, and oligopeptides, prepared via graft-through polymerization

186 l immunosurveillance is based on recognizing oligopeptides presented by MHC class I molecules.

187 The oligopeptide probe was immobilized onto the gate electro

188 Many of the oligopeptides produced by this process are too long to s

189 ereas SC PEP rapidly detoxifies the residual oligopeptide products of EP-B2 digestion.

190 ss of fluorescence, and the buildup of small oligopeptide products.

191 nosomes drives parasite differentiation, and oligopeptides promote stumpy formation in vitro.

192 ture has been determined in complex with the oligopeptide, protease-inhibitor antipain, giving detail

193 Peptidase-generated oligopeptide QS signals being received through TbGPR89 p

194 ction is regulated by their interaction with oligopeptide quorum-sensing signals called short hydroph

195 s: generation and secretion of the signaling oligopeptides, re-internalization of the signaling molec

196 obvious importance, the mechanistic basis of oligopeptide receptor regulation is largely unknown.

197 ge of a chimeric protein system to study the oligopeptide repeat domain (ORD) expansions of the prion

198 cleation and fiber growth, while an adjacent oligopeptide repeat domain is largely dispensable for pr

199 f a pH-responsive, intrinsically disordered, oligopeptide repeat domain of a melanosomal protein.

200 y amino acid composition, the nucleation and oligopeptide repeat domains of Sup35 have distinct compo

201 Suppression required the oligopeptide repeat of the Sup35N prion domain, which is

202 Expansion of the oligopeptide repeats (ORE) found in PrP is associated wi

203 ced conformational differences in one of the oligopeptide repeats (R2) in the N terminus of Sup35 and

204 Oligopeptide repeats appear in many proteins that underg

205 Second, oligopeptide repeats are found in multiple prion protein

206 the Sup35p prion domain, and that the Sup35p oligopeptide repeats are not required for prion maintena

207 ide a general model for studying the role of oligopeptide repeats in prion conformational conversion

208 ne/asparagine rich regions and the number of oligopeptide repeats in the prion domain.

209 rough a mechanism that requires the combined oligopeptide repeats region to which no function has pre

210 t, the position and context of an individual oligopeptide segment within the HVR were significant det

211 on both the number of l-alanine units in the oligopeptide segments and length of the alkylene spacer

212 collagen structure using a relatively simple oligopeptide sequence establishes new opportunities for

213 The short oligopeptide sequence, (N-)PPLRINRHILTR(-C), is identifi

214 h to annotate metagenomes using unique k-mer oligopeptide sequences from 7 to 12 amino acids long.

215 y library, we identified two highly specific oligopeptide sequences RKRIRRMMPRPS and RNRHTHLRTRPR for

216 Other oligopeptides showed weaker or no inhibitory activity.

217 This oligopeptide shows high binding specificity for glyphosa

218 m the chlorination of AAs in combined forms (oligopeptides) significantly exhibited a different patte

219 H derivatives were readily incorporated into oligopeptides site-specifically using standard solid-pha

220 cleavage of glycylphenylalanylleucylglycine oligopeptide spacer, used as GA derivative copolymer att

221 f the reaction using glutathione (GSH) as an oligopeptide stopper, we have employed cytochrome C (Cyt

222 the alkylene spacer between chromophore and oligopeptide substituents.

223 In this assay, an oligopeptide substrate (CLSELDDRADALQAGASQFESSAAKLKRKYWW

224 tical to their preferences displayed against oligopeptide substrates, indicating that GS-7340 and oth

225 the cyanobacteria produce protease inhibitor oligopeptides such as cyanopeptolins and cause drinking

226 Crosslinking occurs via oligopeptide sulphydryl and free amino groups.

227 An application to oligopeptide synthesis was illustrated.

228 Bioactive peptides are oligopeptides that consist of 2-20 amino acids that can

229 demonstrate that exceptional class I binding oligopeptides that escape proteolytic degradation are po

230 relationship (QSAR) model is established for oligopeptides that inhibit angiotensin I-converting enzy

231 We screened an internal library for oligopeptides that inhibited both mushroom and human tyr

232 d using protamine and synthetic polycationic oligopeptides that possess specific cleavage sites that

233 e of carbonyl-containing pharmacophores onto oligopeptides, thus providing a chemical tool for the sy

234 -strand conformation when incorporated in an oligopeptide ("@-tide") strand.

235 udy, the effects and mechanisms of tuna meat oligopeptides (TMOP) on hyperuricemia and associated ren

236 eloped to use the arginine-glycine-aspartate oligopeptide to target angiogenesis and to use bombesin

237 s and not an absolute inability of cytosolic oligopeptides to be transferred to and presented by prof

238 residues promoted sorption of His-containing oligopeptides to CDOM macromolecules through electrostat

239 in proteolysis, transport, and catabolism of oligopeptides to obtain amino acids in this protein-rich

240 Transpeptidases cross-link peptidoglycan oligopeptides to provide vital cell wall rigidity and st

241 of the sensing element is decorated with an oligopeptide, TPFDLRPSSDTR, which is identified by using

242 nsporter of C. trachomatis functions in both oligopeptide transport and peptidoglycan recycling.

243 This supports the contention that oligopeptide transport may have an impact on the extrace

244 s the substrate-binding component of a novel oligopeptide transport system (encoded by lmo0135) was r

245 s the substrate-binding protein (SBP) of the oligopeptide transport system responsible for the import

246 ctive import into bacterial cells through an oligopeptide transport system.

247 oligopeptide binding protein of an apparent oligopeptide transport system.

248 homologs for PrtP and PrtM, and two complete oligopeptide transport systems.

249 condary cell wall biogenesis, cell cycle and oligopeptide transport were mainly downregulated.

250 Genes involved in flagellar biosynthesis, oligopeptide transport, amino acid import and metabolism

251 all three chlamydial OppA subunits supported oligopeptide transport.

252 e Arabidopsis thaliana AtOPT3 belongs to the oligopeptide transporter (OPT) family, a relatively poor

253 The human intestinal oligopeptide transporter (PEPT1) facilitates the absorpt

254 The proton-coupled oligopeptide transporter (POT) YdgR from Escherichia col

255 A sodium-coupled oligopeptide transporter (SOPT1) was described originall

256 al epithelial cells have identified a second oligopeptide transporter (SOPT2).

257 The oligopeptide transporter 1, PepT1, is a member of the Sl

258 he YSL1 and YSL3 proteins are members of the oligopeptide transporter family and are predicted to be

259 The human intestinal proton-coupled oligopeptide transporter hPEPT1 has been implicated in t

260 We report here that an Arabidopsis oligopeptide transporter mutant, opt3-2, over-accumulate

261 is suggests that the putative C. trachomatis oligopeptide transporter OppABCDF (OppABCDF (Ct) ) encod

262 ent reciprocal relationship between the H(+)/oligopeptide transporter PepT1 and apical GLUT2, reflect

263 The oligopeptide transporter PepT1 expressed in inflamed col

264 Both are substrates for the proton-coupled oligopeptide transporter PEPT2.

265 fetal RPE cells express the newly discovered oligopeptide transporter SOPT2, and the transporter is i

266 e findings suggest that Chlamydia evolved an oligopeptide transporter to facilitate the acquisition o

267 eport that OPT3, previously classified as an oligopeptide transporter, is a plasma membrane transport

268 Qsp1 sensing requires an oligopeptide transporter, Opt1, and remarkably, cytoplas

269 PepT2, which belong to the proton-dependent oligopeptide transporter, or POT family.

270 An oligopeptide transporter, PepT1, is transcriptionally up

271 rg; L-KTP) administration in mice lacking an oligopeptide transporter, PEPT2.

272 mease genes (opp1ABCDF), which encode an ABC oligopeptide transporter.

273 for their affinity for hPEPT1, an intestinal oligopeptide transporter.

274 of TbGPR89 predicts unexpected similarity to oligopeptide transporters (POT), and when expressed in b

275 Proton-coupled oligopeptide transporters (POTs) couple the inward trans

276 tered the hfRPE cells via the sodium-coupled oligopeptide transporters 1 and 2 (SOPT1, SOPT2).

277 BC transport systems originally annotated as oligopeptide transporters as candidate transporters for

278 nsceptor CHL1/NRT1.1/NPF6.3 and four related oligopeptide transporters PTR1, 2, 4, and 5 into fluores

279 The oligopeptide transporters SOPT1 and SOPT2 mediate the up

280 Genes encoding putative oligopeptide transporters were often coregulated with ad

281 The proton-coupled oligopeptide transporters, PepT1 and PepT2, have been su

282 PA3934, which belongs to the family of small oligopeptide transporters; and PA5152-5155, which encode

283 ycopeptide dendrimers composed of a branched oligopeptide tree structure appended with glycosidic gro

284 Glycine oligopeptides up to 20 amino acids long were formed with

285 f the 750 kDa particle towards a hydrophobic oligopeptide was nearly two orders of magnitude less tha

286 Coiled-coil formation of four different oligopeptides was characterized in solution, on hydrogel

287 um(II)-catalyzed C(sp(3) )-H alkynylation of oligopeptides was developed with tetrabutylammonium acet

288 However antibody to HVR oligopeptides was not consistently maintained during per

289 ng established the formation of glycine homo-oligopeptides, we then demonstrated the co-condensation

290 Oligopeptides were determined by UPLC/ESI-MS and 35 low-

291 he pKa values of His residues in the studied oligopeptides were found to be between 4.3 and 8.1.

292 rmation rate constants of the His-containing oligopeptides were highly pH-dependent in an environment

293 nt conserved flanking domains, and these HVR oligopeptides were most immunogenic at the time of acute

294 Furthermore acidic oligopeptides were observed to be capable of targeting a

295 Since oligopeptides were sufficient to inhibit growth of the D

296 tect protease by separating amino acids from oligopeptides when proteases cleave the oligopeptides an

297 PR gold sensor chip is modified by using the oligopeptide with a surface density of 0.6 1/nm(2).

298 In this study, AYSSGAPPMPPF (PEPAu), an oligopeptide with an affinity for gold surfaces, was mod

299 nc-dependent hydrolase involved in degrading oligopeptides with 4-12 amino acid residues.

300 A series of oligopeptides with beta-forming and adhesive properties,

301 ational equilibria of the proline-based host oligopeptides with single guests.