ライフサイエンスコーパス: COOH

1 COOH-MWCNTs generated singlet oxygen ((1)O2) and hydroxy

2 io of product ions resulting from either R(1)COOH or R(2)COOH neutral losses is dependent on the natu

3 mputations demonstrate that oxalic acid [1, (COOH)2] exhibits a sequential quantum mechanical tunneli

4 ed peptide (NH(2)-(111)RVREYEKQLEKIKNMI(126)-COOH) that facilitates PKCdelta binding to dF(1)F(0).

5 ompositions, the best fit results for the 16 COOH-SAM thickness and surface roughness on the AuNPs in

6 For the 16 COOH-SAMs on flat Au surfaces, using a SAM thickness of

7 erived peptide (NH(2)-(2)AGRKLALKTIDWVSF(16)-COOH) that inhibits PKCdelta binding to dF(1)F(0) in ove

8 ing at pK(a) = 0.35, corresponding to CClF(2)COOH.

9 prodrug, c,t,c-[Pt(NH(3))(2)(O(2)CCH(2)CH(2)COOH)(OH)Cl(2)] [PLA-Pt(IV)].

10 for protonation of 3,5-di-NO(2)-1 by MeOCH(2)COOH (DeltaG(o) = 13.1 kcal/mol).

11 (3)O(+) and on protonation of X-1 by MeOCH(2)COOH in 50/50 (v/v) HOH/DOD give similar slopes and inte

12 t ions resulting from either R(1)COOH or R(2)COOH neutral losses is dependent on the nature of the ph

13 tin, whereas the ACD truncated on the NH(2), COOH or both ends did not exhibit such actin cross-linki

14 sses the formin homology 1-formin homology 2-COOH region of the protein.

15 maximum for pK(a) = 0, corresponding to CF(3)COOH.

16 -MHA), 11-mercaptoundecane(ethylene glycol)3-COOH (PEG), 3-MPA-LHDLHD-OH, and 3-MPA-HHHDD-OH.

17 (CH(3))(3))(2)-2,2'-bipyridine, dcb is 4,4'-(COOH)(2)-2,2'-bipyridine, and dnb is 4,4'-(CH(3)(CH(2))(

18 (2+) (bpy is 2,2'-bipyridyl and dcb is 4,4'-(COOH)2-2,2'-bipyridyl).

19 with NH(2) (2), NMe(2) (3), OH (4), OMe (5), COOH (6), and COOMe (7), and benzophenone-3,3',4,4'-tetr

20 ence of cholesterol: 57.70 muM for Modelin-5-COOH and 35.64 muM for Modelin-5-CONH(2) compared to the

21 compounds, including 8-hydroxy, 8-oxo, and 8-COOH-linalool, as well as lilac aldehydes and alcohols.

22 ated to ribosome-inactivating proteins and a COOH-terminal domain, which displays similarity to eukar

23 l domain, two separate kinase domains, and a COOH-terminal domain.

24 Proton transfer from a COOH group (DeltaG(double dagger) = 8.36 kcal/mol) or th

25 rvasive changes occur upon conversion from a COOH to a CH(2)OH substituent at C6 than from COOH ioniz

26 arkedly reduced by the catalytic action of a COOH functionality acting as a donor-acceptor group affe

27 ization of Net1 as well as the presence of a COOH-terminal PDZ binding site.

28 ent to a self-assembled monolayer (SAM) of a COOH-terminated alkanethiol.

29 In the same model system, we show that a COOH-terminal truncation mutant of ING4 found in human c

30 ical shifts, and some J-couplings, yielded a COOH pK(a) of 3.0 +/- 0.1 in both anomers.

31 e their properties: (a) the attachment of a -COOH function to the ferrocene fragment leads to the imp

32 ivity due to the presence of a 37 amino acid COOH-terminal region and that this region is capable of

33 unctional group addition is carboxylic acid (COOH) approximately hydroxyl (OH) > nitrate (ONO2) > car

34 n Wnt proteins to activated carboxylic acid (COOH) or glutaraldehyde (COH) groups functionalized on s

35 HCC tumors, whereas natural carboxylic acid (COOH)-truncated HBx was found in the remaining 23 (46%)

36 to the structural contribution of the acidic COOH-terminal region of factor Va heavy chain to factor

37 gene and synthesis of constitutively active COOH-terminally truncated AR variants lacking the AR lig

38 he delta-COOH, an acetol ester for the alpha-COOH, and a tert-butyldimethylsilyl ether for the gamma-

39 tructure of L-ASP exists in an unusual alpha-COOH protonation state.

40 al activity was the cationic and amphipathic COOH-terminus.

41 solvent compared to regions of the NH(2) and COOH domains (dibasic sites 2, 3, and 9-11, respectively

42 ransmembrane domains with both the NH(2) and COOH termini of NGEP located inside the cell.

43 The NH(2)- and COOH-terminal domains both exhibited relatively high H-D

44 oprotein (DSPP) is processed into NH(2)- and COOH-terminal fragments, but its key cleavage site has n

45 he cysteine, proteolytic removal of aaX, and COOH-terminal methylation.

46 oton migrations from N-terminal ammonium and COOH groups to the C-2' position of the reduced His ring

47 sphorylation of the juxtamembrane domain and COOH-terminal docking site of c-Met, and its downstream

48 its NH(2)-terminal actin-binding domain and COOH-terminal EF-hand-GAS2 domain.

49 ble spatial orientation of the imidazole and COOH groups and precluded in the absence of a free carbo

50 uction of IgG Abs that recognize both N- and COOH-terminal epitopes of the human Dsg3 ectodomain.

51 udies are the first to show that the NH2 and COOH termini of sMyBP-C have distinct functions, which a

52 dditional PAM residues placed at the NH2 and COOH termini of VEK30.

53 ontaining unique segments within the NH2 and COOH termini.

54 ations in their long, unstructured, NH2- and COOH-terminal tails.

55 d formation between amino groups of PANI and COOH groups of anti-Cab.

56 J(H4,H5), are unaffected by solution pD, and COOH ionization exerts little effect on J(CH) and J(CC)

57 eted in liver cancer 1 (DLC1) by tensin3 and COOH-terminal tensin-like protein (cten) controls EGF-dr

58 containing) were fused to NH(2) terminal and COOH terminal fragments of the firefly luciferase.

59 Serial NH(2)-terminal and COOH-terminal deletion mutants were constructed and func

60 y exists as the processed NH(2)-terminal and COOH-terminal fragments in the extracellular matrix of t

61 on, is processed into the NH(2)-terminal and COOH-terminal fragments.

62 to the culture medium by SubA treatment, and COOH-terminal domain signal transduction is abrogated, w

63 se mutations in the NH2 terminus (W236R) and COOH terminus (Y856H) of sMyBP-C have been causally link

64 te structural moieties (e.g., -NH(3)(+) and -COOH) and distinct interaction mechanisms (e.g., cation

65 groups at the substrate surface (--OH and --COOH) may also contribute.

66 r or identical amino acid residues; both are COOH-terminally anchored membrane proteins enriched on t

67 e indicates that these functional groups are COOH groups formed by the hydrolysis of carboxylic acid

68 tion of the reduction intermediates, such as COOH*, and the formation of CO.

69 Au-COOH decomposition involves proton transfer to water and

70 dily reacts with adsorbed Au-CO, yielding Au-COOH.

71 e S-transferase chimera of the cargo-binding COOH tail (CT) of MyoVa binds Rab8A and the related Rab1

72 MW, approximately 52 kDa) identified by both COOH- and NH(2)-directed antibodies.

73 ngineered SK mutant fusion protein with both COOH- and NH(2)-terminal His(6) tags.

74 Microcephalin (MCPH1) is a BRCA1 COOH terminal (BRCT) domain containing protein involved

75 this single amino acid deletion in the BRCA1 COOH terminus (BRCT) domain affects the function of the

76 chanism in lung epithelial cells mediated by COOH-terminal Src kinase (Csk) that negatively regulates

77 whereas activation of the MMP10 promoter by COOH-truncated HBx was abolished when the activator prot

78 oxy-p-benzoquinone, or benzene decorated by -COOH groups exhibit ordered magnetic moments, leading to

79 surface acidity of carbon dots imparted by -COOH functionality could effectively catalyze the format

80 adecanoic acid self-assembled monolayer (C16 COOH-SAM) layer thickness on gold nanoparticles (AuNPs)

81 XPS measurements of C16 COOH-SAMs on flat gold surfaces were made at nine differ

82 drocarbon-contamination layer on top the C16 COOH-SAM was necessary to improve the agreement between

83 he percentage of carbonyl (CO) and carboxyl (COOH) groups in oxidized starches also increased with th

84 agnesium oxide (size<10nm) grafted carboxyl (COOH) functionalized multi-walled carbon nanotubes (nMgO

85 the premanent presence of surface carboxyl (-COOH) groups from MAA segments of the copolymer which ca

86 0 = 180 nm) with amino (-NH2), carboxylate (-COOH), phosphate (-PO3H2) or sulfonate (-SO3H) groups af

87 Carboxylated (COOH) and aminated (NH2) polystyrene microspheres were d

88 x10(-10) cm(3) s(-1) and k((CH3 )2 COO + CF3 COOH)=(6.1+/-0.2)x10(-10) cm(3) s(-1) at 294 K exceed es

89 The rate coefficients k(CH2 OO + CF3 COOH)=(3.4+/-0.3)x10(-10) cm(3) s(-1) and k((CH3 )2 COO

90 ds, formic acid (HCOOH) and acetic acid (CH3 COOH), employing two complementary techniques: multiplex

91 rface passivation layer of zinc oxide in CH3 COOH/H2 O and subsequent self-exchange of Zn and Zn(2+)

92 ity associated with the Zn metal and the CH3 COOH/H2 O solution is critically important, as revealed

93 terized by a long, highly positively charged COOH-terminal region, absent in most other chemokines.

94 ere primarily found in the highly conserved, COOH-terminal pore-region domain.

95 These proteins undergo three coordinated COOH-terminal events: isoprenylation of the cysteine, pr

96 peptide, Ac-Arg-Ala-[d-Cys-Arg-Phe-Phe-Cys]-COOH (3).

97 placed as an extra stretch in the cytosolic COOH-terminal region, contributed per se to cold adaptat

98 (D-OH) and carboxyl-terminated 'anionic' (D-COOH) Polyamidoamine (PAMAM) dendrimers were absorbed by

99 The DACH1 COOH terminus was required for binding to PELP1.

100 for Nalpha, a tert-butyl ester for the delta-COOH, an acetol ester for the alpha-COOH, and a tert-but

101 lefinic monocarboxylic acids with CO-derived COOH groups undergoing subsequent stepwise hydrogenation

102 al natural leukocyte- and fibroblast-derived COOH-terminally truncated CXCL9 forms missing up to 30 a

103 (delta-) to form COOH* and then dissociating COOH* to form *CO are 0.37 eV and 0.30 eV, respectively.

104 ring mutations depriving NKCC2 of its distal COOH-terminal tail and interfering with the (1081)LLV(10

105 Since the degree of ionization of the edge -COOH groups is affected by pH, GO's amphiphilicity can b

106 that target co-chaperone binding to the EEVD-COOH motif that terminates Hsp70/Hsp90.

107 olium hexafluorophosphate for more efficient COOH* stabilization exhibit even higher reaction activit

108 that substituents proximal to the exocyclic COOH group (i.e., the C4-O4 bond) influence the activati

109 and Slo1(QEERL), which differ at the extreme COOH terminus, show markedly different steady-state expr

110 Ran, wrapped by the conformational flexible COOH tail.

111 ), CH(3) (medC), CH(2)OH (hmdC), CHO (fmdC), COOH (cadC), F (FdC), or Br (BrdC)], fmdC and cadC exhib

112 barriers of protonating *CO2(delta-) to form COOH* and then dissociating COOH* to form *CO are 0.37 e

113 UVA irradiation removed carboxyl groups from COOH-MWCNT surface while creating other oxygen-containin

114 OOH to a CH(2)OH substituent at C6 than from COOH ionization within the uronides.

115 metry showed that the response of the SPCE-G-COOH enhanced the sensitivity and precision, towards the

116 le modified screen-printed electrode (SPCE-G-COOH).

117 mediator and FDH, deposited onto the SPCE-G-COOH.

118 ly mediate aggregation and attachment (e.g., COOH, NH2, SH, CH3, OH) revealed signatures that reflect

119 howed capture efficiency better than FITC-G6-COOH-5aSlex conjugate.

120 all affinity binding value, KA, of the Au/GO-COOH chip can be significantly enhanced by up to approxi

121 he antigen-antibody interaction of the Au/GO-COOH chip cause this chip to become four times as sensit

122 a BSA concentration of 1mug/ml for an Au/GO-COOH chip, an Au/GO chip and a traditional SPR chip are

123 f carboxyl-functionalized graphene oxide (GO-COOH) composites to form biocompatible surfaces on sensi

124 and the amount of surface functional groups, COOH.

125 Conversely, GRP78 COOH-terminal domain ligation is pro-apoptotic and anti-

126 The predicted 28-kDa GRP78 COOH-terminal fragment is released into the culture medi

127 p > NH(2) in side chain > N-terminal NH(2) > COOH in side chain approximately = C-terminal COOH.

128 tion revealed by DFT computation was CO2 -->*COOH-->*CO-->*COCO-->*COCH2 OH-->*CH2 OCH2 OH-->CH3 CH2

129 dyl)pyrimidine-4-carboxylic acid; Cpp-NH-Hex-COOH = 6-(2-(pyridin-2-yl)pyrimidine-4-carboxamido)hexan

130 ) complexes, namely, [Ru(bipy)(2)(Cpp-NH-Hex-COOH)](2+) (2) and [Ru(dppz)(2)(CppH)](2+) (3) (bipy = 2

131 w potentials, reduction of a resulting Mn(I)-COOH complex at significantly more negative potentials i

132 rnate catalytic pathway-protonation of Mn(I)-COOH to form a cationic tetracarbonyl complex.

133 Without reduction of Mn(I)-COOH, catalysis occurs slowly via a alternate catalytic

134 4,6-tri-tert-butylphenoxyl radical and Ru(II)COOH, with a second-order rate constant of (2.3 0.2) x 1

135 ntermediate I is protonated to form a Fe(II)-COOH species.

136 l)-imidazoliumbromide, a carboxylated IL (IL-COOH), was used to immobilize anti-IgG to create an affi

137 tase (hDHFR) was chelated to the modified IL-COOH.

138 The IL-COOH demonstrated efficient detection of IgG in the nano

139 In addition, the IL-COOH demonstrated low fouling in crude serum, to a level

140 the SPR sensor, it was revealed that the IL-COOH SAM improved the activity of hDHFR by 24% in compar

141 The IL-COOH was further modified with N,N'-bis (carboxymethyl)-

142 Moreover, an intact COOH-terminal PDZ recognition motif (EAKL) in SR-BI is n

143 )(PO(3)H(2))(2)bpy)](2+) are converted into -COOH and H(3)PO(4).

144 ate expression levels of the intramembranous COOH-terminal fragment of cleaved PC1 required an intact

145 he rate-limiting step in each mechanism is **COOH formation at higher negative potentials.

146 and to a lesser extent multi-walled and its COOH-functionalized form induced CAF-like cells, which a

147 n also contains a regulatory element for its COOH-terminal RhoGAP domain.

148 ain another binding site for clathrin in its COOH-terminal region.

149 g during complex formation between SK or its COOH-terminal Lys(414) deletion mutant (SKDeltaK414) and

150 Shot binds along the microtubule through its COOH-terminal GAS2 domain and binds to actin with its NH

151 gating enzyme Ubc13 and the ubiquitin ligase COOH terminus of Hsp70 interacting protein (CHIP) as bei

152 on and interaction with the ubiquitin ligase COOH terminus of Hsp70-interacting protein.

153 is attributed to the strategically located -COOH which accelerates Schiff base formation.

154 nolayer end groups: NH(2) approximately OH < COOH < SH.

155 tracellular signal-regulated kinase-mediated COOH-terminal kinase domain (CTD).

156 ilica (-SiOH) or poly(methyl methacrylate) (-COOH) surfaces, AEX latex attachment is not stable over

157 The MUC1 COOH-terminal subunit (MUC1-C) cytoplasmic domain binds

158 disease is not clear due to loss of multiple COOH-terminal AR protein domains, including the canonica

159 ntly immobilized on the surface of the MWCNT-COOH modified glassy carbon electrode through amide link

160 ith various chain lengths, BODIPY-(CH(2))(n)-COOH (abbreviated as fl-Cn), were observed to adsorb and

161 on assembled carboxylated carbon nanotubes (COOH-CNTs) and poly-L-lysine (PLL) film was developed an

162 f carboxylated multiwalled carbon nanotubes (COOH-MWCNTs), an important environmental process affecti

163 thological analysis, the presence of natural COOH-truncated HBx significantly correlated with the pre

164 tives, featuring hydrophilic group (OH, NH2, COOH) at the para-position of the pendent 2-phenyl ring

165 several analyzed motifs present in the NKCC2 COOH terminus, only those required for ER exit and surfa

166 , this ortho-effect is observed for R = NO2, COOH, CHO, COOEt, COCH3, OCH3, and even CH3, but not for

167 that the presence of dispersed Fe(3)O(4)(np)-COOH does not affect the diffusion limiting currents was

168 solutions containing dispersed Fe(3)O(4)(np)-COOH, 8 and 17 nm in diameter, directly from the Levich

169 Desorption of Cd(2+) from Fe(3)O(4)(np)-COOH, as monitored by the same forced convection method,

170 etic iron oxide nanoparticles, Fe(3)O(4)(np)-COOH, was investigated in situ in aqueous electrolytes u

171 iencies of ~20 mug of Cd/mg of Fe(3)O(4)(np)-COOH, which are among the highest reported in the litera

172 of glassy carbon electrodes: (i) creation of COOH groups, (ii) covalent immobilization of protein A w

173 surface potential and colloidal stability of COOH-MWCNTs, and are expected to reduce their mobility i

174 role in the photochemical transformation of COOH-MWCNTs under UVA irradiation.

175 reaction for Fib detection was performed on COOH-MBs or His-Tag-Isolation-MBs as solid support for t

176 and -SO3H-functionalized alumina but not on -COOH- and -PO3H2-functionalized particles.

177 otected rather than protected -OH, -NHR, or -COOH groups.

178 c functional groups such as -NH(2), -OH, or -COOH revealing the specificity for the detection of thio

179 ective carbene insertion into -NH bond over -COOH and -OH bonds leads to the wide range of carboxy an

180 iously reported Au102(pMBA)44 (pMBA = -SPh-p-COOH); this is a surprise given the much bulkier naphtha

181 minus of the polyprotein H(2)N-RLuc-P1-P2-P3-COOH (P1, structural domain; P2 and P3, nonstructural do

182 otein between P1 and P2 (N(2)H-P1-GLuc-P2-P3-COOH).

183 es with either carboxylic acid (anionic, P3T-COOH) or methylimidazolium (cationic, P3T-MIM) end group

184 In the case of P3T-COOH, the polymer shows a fully reversible phase transfe

185 valently coupled QDs capped with bis(LA)-PEG-COOH to transferrin to facilitate intracellular uptake.

186 thiolated PEG encapsulation (SH-PEG, SH-PEG-COOH) denoted as AuNPs-SQ2-PEG and AuNPs-SQ5-PEG.

187 analogue, Ac-Arg-Ala-[d-Cys-Arg-Phe-His-Pen]-COOH (19), displayed subnanomolar affinity toward CXCR4,

188 f RNAs that bind the dipeptide NH(2)-His-Phe-COOH with K (D) ranging from 36 to 480 muM.

189 (+)-PIM-COOH was also synthesized by the acid hydrolysis of (+)-

190 haracterization, both (+)-PIM-CN and (+)-PIM-COOH were solvent cast directly into semipermeable membr

191 y, absorption of leuprolide into low MW PLGA-COOH particles yielded ~17 wt.% leuprolide loading in th

192 e loading in the polymer (i.e., ~70% of PLGA-COOH acids occupied), and the absorbed peptide was relea

193 ith either nontargeted PLGA-b-PEG-OH or PLGA-COOH.

194 We found that when the PLGA-COOH chains are sufficiently mobilized, therapeutic pept

195 orming a salt with low-molecular weight PLGA-COOH.

196 system (BioMEMS) were functionalized by Ppy-COOH/MNPs, using a chronoamperometric (CA) electrodeposi

197 ization was performed in order to ensure Ppy-COOH/MNPs electrodeposition on the microelectrode surfac

198 due to the promoting effect of the proximate COOH group.

199 PS-COOH accumulated inside embryo's digestive tract while P

200 PS-COOH forms microaggregates (PDI > 0.4) in NSW, whereas P

201 1 gene resulted up-regulated at 48 hpf by PS-COOH whereas PS-NH2 induced cas8 gene at 24 hpf, suggest

202 rface charges where chosen, carboxylated (PS-COOH) and amine (PS-NH2) polystyrene, the latter being a

203 No embryotoxicity was observed for PS-COOH up to 50 mug mL(-1) whereas PS-NH2 caused severe de

204 (Si) and 100 nm carboxylated polystyrene (PS-COOH) NPs cloaked by human plasma HC were titrated with

205 pyrrole-co-pyrrole-2-carboxylic acid) (Py/Py-COOH) for high efficient detection of SPy.

206 ward, SA2-BSA was covalently bonded to Py/Py-COOH/MNP modified gold WEs through amide bonding.

207 Rab11-GTP associates with the Rabin8 COOH-terminal region and is required for Rabin8 precilia

208 essing in vivo, as a result of which JIP60's COOH-terminal eIF4E domain is released and functions in

209 f the COOH-terminal region of CXCL9, several COOH-terminal peptides were chemically synthesized.

210 5 is modified with sulfenic acid on a single COOH-terminal cysteine (C581), and the level of sulfenic

211 The SK COOH-terminal Lys(414) residue and residues Arg253-Leu26

212 eractions between a Pg/Pm kringle and the SK COOH-terminal Lys(414).

213 y small except for polar ortho-substituents (COOH, NO(2)).

214 ation reaction the concentration of surface -COOH groups can be carefully controlled.

215 Use of the optimum level of SWNT -COOH functionality allowed the construction of a prototy

216 fected by inflammatory cytokines that target COOH-terminal serine residues to activate ubiquitination

217 almitic acid, whereas the analogous terminal COOH-containing OxPCs demonstrated a NL of 256.

218 n (Ubl) by adenylation of the Ubl C-terminal COOH group and then forms a thioester bond with the aden

219 hioester bond with the adenylated C-terminal COOH group of the Ubl.

220 OOH in side chain approximately = C-terminal COOH.

221 ic hydrogen atom migration from the terminal COOH group onto the His imidazole ring, forming imidazol

222 Our data suggest that COOH truncation of HBx, particularly with 24 amino acids

223 THC-COOH was rapidly removed from both deionized (DI) water

224 para position of the phenol structure of THC-COOH was confirmed by detection of monochlorinated bypro

225 r-9-carboxy-Delta9-tetrahydrocannabinol (THC-COOH) were shown to be strongly correlated to NH4-N.

226 9-carboxy-Delta(9)-tetrahydrocannabinol (THC-COOH) with chlorine.

227 9-carboxy-Delta(9)-tetrahydrocannabinol (THC-COOH), 11-hydroxy-Delta(9)-tetrahydrocannabinol (11-OH-T

228 ol (THC), 11-nor-9-carboxy-Delta(9)-THC (THC-COOH) and 11-hidroxy-Delta(9)-THC (THC-OH) in milk, live

229 The COOH terminus of periplakin was shown to have a strong a

230 The COOH-terminal domain of ZO-1 was required for its associ

231 The COOH-terminal fragment retained antibacterial activity w

232 The COOH-terminal NP domain comprises a conserved highly aci

233 The COOH-terminal peptide CXCL9(74-103) does not signal thro

234 The COOH-terminal region of the heavy chain contains acidic

235 e oxidized N-DNW electrode by activating the COOH group of N-DNW using ethyl(dimethylaminopropyl)carb

236 identate complexation between the Cu and the COOH groups during the first half cycle of the ALD react

237 through the NH(2) terminus of BRCA2 and the COOH terminal BRCT domains of MCPH1.

238 f factor Va contains an acidic region at the COOH terminus (residues 680-709).

239 kinase domains, SK1 and SK2, present at the COOH terminus of giant obscurin-B.

240 tion, the presence of the VEDEC motif at the COOH terminus of Slo1 channels is sufficient to confer a

241 y a complete blockade of synergy between the COOH-terminal SAA1 fragments and CXCL8 or CCL3 in neutro

242 This conformational change exposes the COOH-terminal tail of Syk, which has three conserved Tyr

243 The measured acidities for the COOH and OH groups of coumaric and caffeic acids are 332

244 ith CyArg suggests an important role for the COOH group during catalysis.

245 at amino acid region (695)DYDY(698) from the COOH terminus of the heavy chain of factor Va regulates

246 Additional interactions from the COOH-terminal half of vWbp(1-474) strengthened the initi

247 urface, with the exception of changes in the COOH and Si-O vibrations indicating chemical bonding.

248 ge of the nuclear localization signal in the COOH region of 2A to enhance its trafficking to the nucl

249 VEGF-Ax has a 22-amino-acid extension in the COOH terminus and has been reported to function as a neg

250 2 to induce phosphorylation of Ser375 in the COOH terminus of the receptor, to induce association of

251 l as a distinct conformational change in the COOH-proximal half of MRP1.

252 N is acetylated on Lys(402), which is in the COOH-terminal PDZ domain-binding motif.

253 thermore, mutation of these tyrosines in the COOH-terminal region of Syk transforms it to an enzyme,

254 e truncated proteins, some of which lack the COOH-terminal catalytic domain.

255 ectively, released distinct fragments of the COOH- and NH2 -terminal regions.

256 To investigate the role of the COOH-terminal region of CXCL9, several COOH-terminal pep

257 Deletion of the COOH-terminal SkzL Lys(415) residue reduces affinity for

258 Inducible stable expression of the COOH-truncated HBx protein (with 24 amino acids truncate

259 ch were truncated on either the NH(2) or the COOH terminal, as well as on both ends, were expressed f

260 The core structure of Ran, outside the COOH tail, is not altered by L(M) binding and remains ac

261 is imidazoline intermediates that reform the COOH group and result in His ring isomerization.

262 This binding requires the COOH-terminal thrombospondin type 1 repeats of the prote

263 inding and motility assays, we show that the COOH terminus mediates binding of sMyBP-C to thick filam

264 face GRP78 topology and demonstrate that the COOH-terminal domain is necessary for pro-apoptotic sign

265 evel of regular structure, implying that the COOH-terminal half of the alphaC-domain adopts an ordere

266 It was found that the COOH-terminus of FPC and the NH2-terminus of PC2 interac

267 tivity and, notably, when transferred to the COOH terminus of a warm-adapted (rabbit) PEPT1, it confe

268 Proximate to the COOH terminus of the BRCA2 protein, a conserved and DNA

269 two conserved tyrosines located close to the COOH terminus of the protein-tyrosine kinase Syk.

270 e start of the nearby TnI helix 1 and to the COOH terminus of the TnT-TnI coiled-coil.

271 two PAM residues (Arg(126)-His(127)) to the COOH terminus of VEK30 (VEK32) maintained a monomeric pe

272 helices 1-6, including Loop 1) binds to the COOH-terminal portion (containing TM helices 7-8 and Loo

273 Furthermore, Pg binding to the COOH-terminal region of GRP78 stimulates cell proliferat

274 sisting of a short degron, CL1, fused to the COOH-terminus of green fluorescent protein (GFPu).

275 ch exhibited different reactivity toward the COOH-MWCNT surface.

276 ion that assists in H2 activation, while the COOH groups facilitate rapid proton movement.

277 4a/b, Ddb1, and Crbn, and interacts with the COOH terminus of the ACR via Crbn.

278 that a small 53-amino acid region within the COOH-terminal domain can interact with the tail region o

279 were dense, relatively defect-free, and the -COOH was exposed to the surface.

280 other members of the SLC12A family, of their COOH terminus.

281 sites by regulating interactions with their COOH-terminal guanylate kinase-like domains (GKs).

282 ions removes the undesirable effect of these COOH groups almost completely.

283 domain, triggering EZH2 degradation through COOH terminus of Hsp70-interacting protein (CHIP)-mediat

284 ties for the interacting TnI helix 1 and TnC COOH-domain.

285 actin, the TnT-TnI coiled-coil, and the TnC COOH domain that contains the regulatory Ca(2+) sites in

286 HDX of the TnI COOH terminus indicated that its known role in regulatio

287 Most of the TnI COOH terminus was protected from H/D exchange, implying

288 been described as a mechanism giving rise to COOH-terminally truncated, constitutively active AR isof

289 MLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes.

290 g-tagged TrkBT1 but not a Flag-tagged TrkBT1 COOH-terminal deletion mutant (Flag-TrkBT1DeltaC) in non

291 wn forms of MyBP-C slow, but it has a unique COOH terminus.

292 cript variant of TrkB (TrkBT1) with a unique COOH-terminal 12-amino acid sequence and is mainly local

293 of nuclear import can be augmented by unique COOH-terminal sequences that reconstitute classical AR N

294 etal myofibers with antibodies to the unique COOH terminus of variant-1 demonstrated that, unlike oth

295 apoptotic signal transduction occurring upon COOH-terminal antibody ligation.

296 In comparison, PS NP coated with COOH (possessing negatively charged surfaces) in the siz

297 ) provided characteristic product ions, [R(x)COOH + Ag](+), and their neutral losses.

298 spholipids with unsaturated fatty acids (R(x)COOH, x = 1 or 2) provided characteristic product ions,

299 of 10-mer chemerin peptide NH(2)-YFPGQFAFSK-COOH by removing the carboxyl-terminal lysine (K).

300 a prochemerin peptide (NH(2)-YFPGQFAFSKALPRS-COOH) or recombinant full-length prochemerin by plasmin