ライフサイエンスコーパス: human plasma

1 1-10 pg/mL PSA was also achieved in diluted human plasma.

2 ction of prostate cancer (PCa) biomarkers in human plasma.

3 their ability to neutralize FVIII in normal human plasma.

4 l provided excellent stability in monkey and human plasma.

5 he target DNA in the hybridization buffer or human plasma.

6 de metabolite, BMS-801576, concentrations in human plasma.

7 as good chemical and enzymatic stability in human plasma.

8 sease-relevant platelet aggregation assay in human plasma.

9 -induced complement activation in autologous human plasma.

10 /MS) bioanalytical assay of dapagliflozin in human plasma.

11 key soluble complement-regulating protein in human plasma.

12 o 50 femtogram of PFCs, in one microliter of human plasma.

13 on of insulin-like growth factor 1 (IGF1) in human plasma.

14 ied for selective extraction of quinine from human plasma.

15 to generate different coagulation times for human plasma.

16 This approach was further investigated from human plasma.

17 were within quantification range in control human plasma.

18 on product phloroglucinol aldehyde (PGAL) in human plasma.

19 of unconjugated fatty acids (FA) in fish and human plasma.

20 ct human insulin and five insulin analogs in human plasma.

21 ococcal agglutination with fibrin fibrils in human plasma.

22 successfully applied to real samples such as human plasma.

23 ffectively diagnoses protein C deficiency in human plasma.

24 presence had not been previously observed in human plasma.

25 ndard Reference Material 1950 Metabolites in Human Plasma.

26 .6 muIU/mL) for each insulin from 250 muL of human plasma.

27 f its low solubility and fast clearance from human plasma.

28 TRX80 showed an age-dependent increase in human plasma.

29 200 ng mL(-1) and high accuracy for diluted human plasma.

30 rch for loci contributing to DBH activity in human plasma.

31 s successfully applied to detect thrombin in human plasma.

32 al concentrations in cell culture medium and human plasma.

33 sin, trypsin, and chymotrypsin and stable in human plasma.

34 andwich assay was 7.3 pM in BSA and 15 pM in human plasma.

35 her with an increased enzymatic stability in human plasma.

36 minant thiol/disulfide redox couple found in human plasma.

37 inically relevant sensitivities in undiluted human plasma.

38 t are representative of those found in adult human plasma.

39 el-free detection of an analyte in undiluted human plasma.

40 The stability of (44)Sc-cm09 was tested in human plasma.

41 inds ~70% of amyloid beta-peptide (Abeta) in human plasma.

42 polymease chain reaction (RT-PCR) on HCV(+) human plasma.

43 vels of TF that clotted factor VII-deficient human plasma.

44 y the ligands for these virulence factors in human plasma.

45 f different glycoisoforms of intact ApoC3 in human plasma.

46 e plasma mimic the metabolite composition of human plasma.

47 ELISA to measure intact BPDE-HSA directly in human plasma.

48 ut oil unlike to moderate sn-3 preference in human plasma.

49 0.34 pg mL(-1) in PBS and 0.88 pg mL(-1) in human plasma.

50 factor IXa and prolongs the clotting time of human plasma.

51 t of rare proteins from buffer solutions and human plasma.

52 response of phenol conjugate metabolites in human plasma.

53 e differences in protein abundance levels in human plasma.

54 n molecules, and complement factors on CC in human plasma.

55 patterns within complex lipidomes including human plasma.

56 iological thiols such as glutathione) and in human plasma.

57 sa than the naturally-occurring AMP LL-37 in human plasma.

58 r genetic or iatrogenic iron overload and in human plasma.

59 ystem for the detection of EVs isolated from human plasma.

60 lity was evaluated on PLGA nanoparticles and human plasma.

61 ndogenous alpha-1-acid glycoprotein (AGP) in human plasma.

62 tein phosphorylation when compared to normal human plasma.

63 MS/MS bioanalysis of pasireotide (SOM230) in human plasma.

64 ed partial thromboplastin time of baboon and human plasmas.

65 fibrinogen from FXIII-A-deficient mouse and human plasmas.

66 dC concentrations present in murine, but not human, plasma.

67 l for evaluating the antioxidant capacity of human plasma after acute intake of tea.

68 Material (SRM) 1950, "Metabolites in Frozen Human Plasma", against benchmark consensus mean concentr

69 stable in vitro in FBS, BALB/c-nu plasma and human plasma, although release of the drug at HT was inc

70 In human plasma, an inverse correlation of miR-195 was obse

71 In addition, both BMP10 in human plasma and BMP10 secreted from the mouse right atr

72 otent activator of the complement cascade in human plasma and caused deposition of C5b-9 on the plate

73 all analogs were calculated in 6 sources of human plasma and CVs of the matrix factors were <15% in

74 Both (R)-9b and (S)-9b were stable in human plasma and displayed a long half-life (t(1/2) > 6

75 tests, we find SSTNIGF1R is highly stable in human plasma and displays a half-life of 27 hours in mic

76 ACE2) on peptide metabolism was evaluated in human plasma and explanted heart tissue from patients wi

77 n quantification in buffer, human serum, and human plasma and for assaying hormone secretions from en

78 Metabolomics analyses of human plasma and HaCaT cells were used to compare the ab

79 a high-molecular-weight leptin complex from human plasma and identified clusterin as a major compone

80 aintained higher levels of stability both in human plasma and in mice than the corresponding maleimid

81 onalization on protein arrays from undiluted human plasma and indicates the great potential of the pC

82 eased the biologically active C5a peptide in human plasma and induced migration of neutrophils.

83 cells were treated with Lp(a) purified from human plasma and Lp(a) uptake studied using Western blot

84 cells were treated with Lp(a) purified from human plasma and Lp(a) uptake studied using Western blot

85 ss with biological samples both postprandial human plasma and lung samples from ferrets were analysed

86 /59 fragment was identified post-MI, both in human plasma and mouse LV, at levels that inversely corr

87 validated our assay performance using pooled human plasma and NIST SRM 1950 samples.

88 es the calculation of the GSH:GSSG ratios in human plasma and saliva samples.

89 mino acids and amino-containing compounds in human plasma and serum using precolumn derivatization wi

90 tivation in normal, as opposed to deficient, human plasma and serum.

91 all-trans geometric isomer in foods, whereas human plasma and tissues show greater proportions of cis

92 sitive and selective determination of Fib in human plasma and urine.

93 Shed sTim-3 was found in human plasma and was significantly elevated during early

94 IgG4) directly in unfractionated samples of human plasma and we detect traces of previously unreport

95 rapidly hydrolyzed in rat plasma but not in human plasma and were stable in simulated gastrointestin

96 vented activation of factor IX and prolonged human plasma and whole blood clotting.

97 tion of the thrombin inhibitor dabigatran in human plasma and whole blood samples, highlighting its p

98 f the integrative approach, bacterial cells, human plasma, and cancer cells were analyzed by combined

99 of naturally occurring anti-influenza Abs in human plasma, and did not differ between HCMV(+) and HCM

100 trovafloxacin at drug concentrations seen in human plasma, and its inhibition led to dysregulated fra

101 e drug from the proteins that are present in human plasma, and some of the peptides are capable of di

102 e tested on common samples for metabolomics, human plasma, and urine.

103 ose minor alleles are associated with higher human plasma ANP levels.

104 red cabbage anthocyanins bioavailability and human plasma antioxidant capacity.

105 rest because high levels of this molecule in human plasma are associated with an increasing risk of c

106 Acylcarnitines spiked to human plasma as a donor phase were extracted reproducibl

107 engineered library is structurally stable in human plasma as well as being hemocompatible (non-hemoly

108 zymatic release of payload from ADC-depleted human plasma at 144 h was able to account for almost 100

109 d in the liver hepatocytes and is present in human plasma at trace levels (picomolar or nanograms per

110 centrations routinely achieved clinically in human plasma, atovaquone inhibits STAT3 phosphorylation,

111 mbers of diverse RNA virus families within a human plasma background, some present at very low levels

112 drug (levothyroxine) and its metabolites in human plasma, based on precolumn derivatization followed

113 ino)hexanoate (13d), was stable in swine and human plasma but liberated 14 in swine brain homogenate.

114 Human plasma butyrylcholinesterase (BChE) inactivates th

115 In conclusion, lunasin can be isolated from human plasma by a simple DEAE microspin column technique

116 proach to investigate the entire spectrum of human plasma cell neoplasia and illustrate the utility o

117 recapitulates the systemic manifestations of human plasma cell neoplasms, and implicates cooperativit

118 Long-lived human plasma cells (PCs) play central roles in immunity

119 The anti-FcRH5/CD3 TDB kills human plasma cells and patient-derived myeloma cells at

120 CD28 is also expressed on murine and human plasma cells but its function on these cells remai

121 ight-chain production and cause apoptosis in human plasma cells making intact IgGlambda antibodies.

122 mbda-light-chain production and secretion by human plasma cells regardless of sequence diversity.

123 cal memory based upon intrinsic longevity of human plasma cells.

124 ties to a range of other proteins, including human plasma ceruloplasmin.

125 Moreover, they are effective inhibitors of human plasma clotting in vitro.

126 established for purified blood proteases or human plasma clotting isotropically.

127 ncer and the repertoire of autoantibodies in human plasmas collected at a preclinical time point and

128 We confirmed that human plasma contains immunoglobulins that can neutraliz

129 s purified from either conditioned medium or human plasma could partially rescue the defects of HSCs

130 nity pull-down mass spectrometry analysis in human plasma demonstrated that the protein interacts wit

131 we demonstrate the detection of TNFalpha in human-plasma derived samples as an example for point-of-

132 Preincubation of HDL3 with human plasma-derived active PLTP resulted in the formati

133 plores critical issues in the development of human plasma-derived Hp and hemopexin as therapeutics fo

134 The samples taken from monkey or human plasma during PET measurements were directly injec

135 Altered cargo proteins of human plasma endothelial cell-derived exosomes in athero

136 lated N-glycan fraction from haptoglobin and human plasma, enriched using weak anion exchange chromat

137 47 Da over the native albumin extracted from human plasma, exactly matching the mass of the linker-pa

138 vascular endothelial growth factor (VEGF) in human plasma for cancer diagnosis.

139 olar activity toward HIV-1 and are stable in human plasma for more than 24 h with a therapeutic index

140 uality control samples, reference plasma and human plasma from a real nutrimetabolomic study were use

141 In human plasma from cancer patients, there were higher lev

142 oring of the glucose and L-lactate levels in human plasma from patients with diabetes is demonstrated

143 A total of 420 human plasma from two cities (Halle and Munster, Germany

144 ins from nonpregnant rats (n=6-7/group) with human plasma from women with EPE, LPE, or NP and measuri

145 ious concentrations of HFA spiked in diluted human plasma further demonstrates the potential utility

146 In addition, human plasma had a neutralizing effect on cytotoxicity o

147 he mass of the major protein in ADC-depleted human plasma had an additional 1347 Da over the native a

148 high plasma protein binding abilities and a human plasma half-life of 160 min, resulting in formatio

149 r determination of GM2, GM3, GD2, and GD3 in human plasma has been developed and validated.

150 analysis of methylglyoxal as a biomarker in human plasma has been developed.

151 Size-exclusion chromatography of human plasma has shown PCSK9 to be partly associated wit

152 xylated polystyrene (PS-COOH) NPs cloaked by human plasma HC were titrated with 3-[(3-Cholamidopropyl

153 ze and composition, isolated subfractions of human plasma HDL, cell lines stably expressing ABCA1 or

154 econd most abundant protein after apo A-I of human plasma high-density lipoproteins (HDL), is the mos

155 bolite concentrations comparable to those of human plasma (human plasma-like medium [HPLM]).

156 In humans, plasma hyperosmolality delays the onset of sweat

157 Application of this online platform to human plasma identified 376 glycated peptides from 10 mu

158 stones H3 and H4 triggered TG in recalcified human plasma in a platelet-dependent manner.

159 at canagliflozin concentrations measured in human plasma in clinical trials and was caused by inhibi

160 determination of a model peptide spiked into human plasma in the range of 0.45-9.0 mug/mL is demonstr

161 potassium were also determined in undiluted human plasma in the therapeutic concentration range.

162 Several splice variants of IgE exist in human plasma, including a variant called IgE-tailpiece (

163 ted peptides quantified in in vitro glycated human plasma increased more than 3-fold using this platf

164 to 4000 IU/L, phosphocreatine 5 mM) added to human plasma induced a dose-dependent reduction to compl

165 untreated or hTNFalpha-treated PAEC with 10% human plasma induced complement C3b/c and C5b-9 depositi

166 C with CHC (100 microg/ml) protected against human plasma-induced endothelial activation and damage.

167 und no evidence that progranulin in mouse or human plasma is a component of HDL either by ultracentri

168 whether polymeric IgA (pIgA) recovered from human plasma is able to associate with secretory compone

169 The use of convalescent-phase human plasma is an effective treatment in humans infecte

170 ccurate quantification of 36 NEFA species in human plasma is described, the highest numbers ever repo

171 SRM 1950 Metabolites in Human Plasma is intended to have metabolite concentratio

172 ed reduction of these chemicals over time in human plasma is presumably related to the phase-out of P

173 or for detection of myeloperoxidase (MPO) in human plasma is reported.

174 Using TWIMS in biomarker discovery in human plasma is thus recommended.

175 When myeloperoxidase was added to human plasma it became bound to other proteins and was r

176 is the first study to characterize sTim-3 in human plasma, its source, and mechanism of production.

177 on study of serum scuPAR levels identified a human plasma kallikrein gene (KLKB1) promoter polymorphi

178 In humans, plasma KIM-1 levels were higher in patients with

179 haptoglobin (Hp)-hemoglobin (Hb) complex in human plasma leads to a high affinity recognition by the

180 rations comparable to those of human plasma (human plasma-like medium [HPLM]).

181 s, such as phospholipids, were determined in human plasma lipid extracts.

182 te concentrations within even 2-fold diluted human plasma may be determined reliably using as few as

183 ospholipids from biological samples, such as human plasma, MDA-modified LDL and Cu(2+)-oxidized LDL.

184 ratio of metabolites in animal plasma versus human plasma measured over approximately 1 year apart we

185 This prodrug is stable in acid and human plasma media, but it is efficiently processed in h

186 dopamine in human cell lines expressing the human plasma membrane dopamine transporter (DAT) and hum

187 small molecule standards and, separately, on human plasma metabolite extracts.

188 cally important differences in water soluble human plasma metabolome.

189 g the glycosylation of a cancer biomarker in human plasma, MUC5AC, using only 20 muL of the plasma.

190 Analysis of the human plasma N-glycome allowed high-throughput detection

191 ontaining mixtures such as PNGase F-released human plasma N-glycome.

192 The capacity to isolate immunochemically human plasma neuron-derived exosomes (NDEs), containing

193 onversely, when strain PC574 was cultured in human plasma, no similar increase in hemolytic activity

194 nonspecific protein adsorption to undiluted human plasma on both the antibody immobilized pCB spots

195 y of camouflaged construct was maintained in human plasma or blood.

196 l-length Angptl4, and the effect was seen in human plasma or in the presence of albumin.

197 ittle as 1 PFU of ZIKV in 100 mul of saline, human plasma, or human urine.

198 he parental strain in growth in human serum, human plasma, or sheep or horse blood.

199 In human plasma, osmotic shock increased cBIN1 detection by

200 In vitro, (44)Sc-cm09 was stable in human plasma over the whole time of investigation and sh

201 the SsE homologue in Streptococcus equi, and human plasma PAF-AH (hpPAF-AH).

202 coccus pyogenes (GAS) interacts tightly with human plasma plasminogen (hPg) and plasmin (hPm) via the

203 Cargo proteins of human plasma platelet-derived exosomes may biomark plate

204 Human plasma platelet-derived exosomes: effects of aspir

205 ry program increased the fraction unbound to human plasma protein from below minimum detection levels

206 tification of genetic variants affecting the human plasma protein profile by combining high-throughpu

207 exploited to improve the fraction unbound to human plasma protein while retaining biochemical potency

208 Treatment with the naturally occurring human plasma proteins haptoglobin or hemopexin may have

209 gh surface area and high pore volume towards human plasma proteins has been investigated.

210 Organization's (HUPO's) pilot initiative on Human Plasma Proteome Project.

211 Organization's (HUPO's) pilot initiative on Human Plasma Proteome Project.

212 mple-processing pipeline for analysis of the human plasma proteome that provides greatly increased de

213 Compared to the comprehensive human plasma proteome, 5 of 11 serum proteins had a diff

214 cofactor II (HCII), a key serpin present in human plasma, remain unknown.

215 g factors or whether such activity exists in human plasma remains unknown.

216 xidized low-density lipoproteins (OxLDL) and human plasma, respectively, their analysis as risk bioma

217 AHHAHHAAD spiked in a protein digest and in human plasma, respectively, were used as the samples to

218 tical performance, four drugs were spiked to human plasma, resulting in highly acceptable precision (

219 that better recapitulates the composition of human plasma reveals unforeseen metabolic wiring and reg

220 on of cholesteryl esters from TG fraction of human plasma sample using our chiral HPLC/APCI-MS method

221 m gel electrophoresis of an albumin-depleted human plasma sample were excised for in-gel MAAH LC-MS a

222 cal application for methylation detection in human plasma sample.

223 saturated fatty acyls is observed in case of human plasma sample.

224 and active enzyme) from 70 muLpost-exposure human plasma sample.

225 immunoglobulin G and/or immunoglobulin M in human plasma samples after treatment.

226 To this end, we used 126 identical human plasma samples and 29 quality control samples from

227 In comparison, only 2 out of 42 (5%) human plasma samples collected in a similar time frame o

228 ical detection of the anesthetic propofol in human plasma samples for clinical diagnoses.

229 Studies utilizing human plasma samples from healthy donors and patients wi

230 cation of the proposed method to measure 124 human plasma samples from orchard workers and cotton far

231 A total of 420 human plasma samples from two cities (Halle and Munster,

232 tiomers and regioisomers in hazelnut oil and human plasma samples is determined.

233 Analysis of 71 human plasma samples uncovered a strong correlation betw

234 urface (MAPS), for measuring MPO activity in human plasma samples using the bioluminescent substrate

235 To evaluate these models, human plasma samples were analyzed by LC-HRMS on an Orbi

236 values determined for the two analytes in 35 human plasma samples were in excellent agreement with th

237 roach can remove 95% of the total albumin in human plasma samples while retaining close to 100% for t

238 bled the selective Se speciation analysis of human plasma samples without the need of extensive clean

239 In 330 human plasma samples, a positive association between amy

240 We demonstrated that, as for human plasma samples, ASAP(2) is efficient in analyzing

241 se microarrays and hybridized with mouse and human plasma samples, respectively.

242 When applied to a training set of human plasma samples, the protocol allowed for the rapid

243 In human plasma samples, we demonstrate that blocking of hi

244 ics data set derived from approximately 3000 human plasma samples, we find that application of our al

245 c/hydrophilic LC-MS/MS analysis of mouse and human plasma samples, which enables the untargeted ("sho

246 of the total enzyme amount in post-exposure human plasma samples.

247 ion and sensing of propofol molecules in the human plasma samples.

248 mouse tissues, nonhuman primate tissues, and human plasma samples.

249 at can recognize thrombospondin-1 protein in human plasma samples.

250 ect total (14)C count measurements in <2 muL human plasma samples.

251 carry out the successful analysis of MPO in human plasma samples.

252 g and smoking-related biomarker discovery in human plasma samples.

253 der different experimental conditions and of human plasma samples.

254 form for measuring the total amount of OT in human plasma/serum.

255 icrospin column to isolate spiked lunasin in human plasma showed that most lunasin (37.8-46.5%) bound

256 hysema, infusion of purified AAT from pooled human plasma-so-called "augmentation therapy"-represents

257 nel (Life Technologies, Carlsbad, CA) and 50 human plasma specimens.

258 Starting with human plasma spiked with whole, live E. coli cells, this

259 Tolcapone binds specifically to TTR in human plasma, stabilizes the native tetramer in vivo in

260 lity in terms of biological sample analysis (human plasma), temporal stability, and reusability was a

261 We recently identified 156 proteins in human plasma that were each associated with the net Fram

262 cific modification of endogenous fetuin A in human plasma, the synthesis of tandem fluorophore-protei

263 Together with an increased lifetime in human plasma, the thermostable GeoCas9 provides the foun

264 y achieves the required sensitivity range in human plasma to allow reliable differentiation between h

265 ty of vinyl sulfonamide 4 are good enough in human plasma to serve as a starting point for medicinal

266 Moreover, addition of human plasma to the culture in FBS appeared to inhibit t

267 lbumin-AalphaC adducts were characterized in human plasma treated with N-oxidized metabolites of Aalp

268 /= 24 hours on biomaterials conditioned with human plasma under venous shear in iron-free cell cultur

269 alpha1-Antitrypsin (A1AT) purified from human plasma upregulates expression and release of angio

270 es and internal standard were extracted from human plasma using a simple protein precipitation proced

271 o develop a method of isolating lunasin from human plasma using an ion-exchange microspin column and

272 ation of empagliflozin (25-600 ng mL(-1)) in human plasma using dapagliflozin as an internal standard

273 profiling of NIST SRM 1950, "Metabolites in Human Plasma", using GC-MS, LC-MS, and NMR.

274 First, we generated high purity apoA-I from human plasma, using thiophilic interaction chromatograph

275 es PKal activity in vitro in both murine and human plasma, via a factor XII (FXII)-dependent mechanis

276 Afamin is a human plasma vitamin E-binding glycoprotein primarily ex

277 orted tissue factor-dependent coagulation in human plasma, vs. APL with longer or shorter fatty acyl

278 y for the standard curve points in extracted human plasma was 99-100%.

279 Human plasma was analyzed in triplicate using liquid-chr

280 Staphylococcus aureus coagulation of human plasma was associated with the recruitment of prot

281 for quantitative analysis of pasireotide in human plasma was evaluated and compared to those obtaine

282 Quantitative detection of MMP-7 in human plasma was further demonstrated with a LOD of 40 n

283 The sequence of the peptide isolated from human plasma was HSGFEDELSEVLENQSSQAELKEAVEEPSSKDVME.

284 cells in FBS, and a higher concentration of human plasma was necessary to reduce the cytotoxicity of

285 The results were also reproducible when the human plasma was present in our assay system.

286 post-prandial absorption of sapotexanthin to human plasma was proven for the first time.

287 Human plasma was spiked with pasireotide with concentrat

288 The direct detection of sunitinib in human plasma was successfully demonstrated by fluorescen

289 The in vitro analysis of potassium in human plasma was successfully demonstrated with this app

290 thods for the profiling of micronutrients in human plasma, we introduce a novel, validated workflow f

291 nding and radiometabolism of [(11)C]PBR28 in human plasma were achieved for up to 50 min after radiol

292 n, and human IgG) and a complex mixture from human plasma were fully deglycosylated in 20 min, withou

293 When nanoworms pre-coated with human plasma were injected into mice, C3 and other adsor

294 terminations of NO2(-) and NO3(-) present in human plasma, whole blood and saliva samples.

295 port on reagentless cholesterol detection in human plasma with a novel single-enzyme, membrane-free,

296 ion (mean bias <10%) of polar metabolites in human plasma with good reproducibility (CV approximately

297 ive analysis of the drug enalapril in pooled human plasma with ramipril as an internal standard, a gr

298 the measurement of thrombin added to healthy human plasma with same high sensitivity and a limit of d

299 nonhuman primates that repeated exposure to human plasma with trace amounts of HCV induced HCV-speci

300 eous detection of both antibiotics in spiked human plasma within a sample-to-result time of less than