ライフサイエンスコーパス: oligopeptide

1 ly because of the presence of R and D in the oligopeptide.

2 ll-length bacterial protein inhibited by the oligopeptide.

3 nitiation at AUG872, yielding a proline-rich oligopeptide.

4 nificantly reduced by a small JPH2-mimicking oligopeptide.

5 generated T cells against several cyclin-A1 oligopeptides.

6 ufficient to promote proton uptake for these oligopeptides.

7 a, lacked antibodies recognizing linear LcrV oligopeptides.

8 (TAAC) polymerization to 1,4-triazole-linked oligopeptides.

9 ic, yet tight, seal around the translocating oligopeptides.

10 ration of dipeptides from hemoglobin-derived oligopeptides.

11 ode PatS C-terminal 4 (GSGR) to 8 (CDERGSGR) oligopeptides.

12 ary X-Gly peptide bond in a set of analogous oligopeptides.

13 synthesis by blocking the passage of nascent oligopeptides.

14 permeable to amino acids yet impermeable to oligopeptides.

15 mass spectrometric analyses of the generated oligopeptides.

16 a mesh-like network comprised of sugars and oligopeptides.

17 rmation of histidine (His) in His-containing oligopeptides.

18 ively liberate most dipeptides from nutrient oligopeptides.

19 iles show the full potential of the employed oligopeptides.

20 ino acids, and water-soluble X5 and X10 homo-oligopeptides.

21 stematically evaluated for a series of model oligopeptides.

22 for modelling the ACE inhibition activity of oligopeptides.

23 A pyrene-functionalized cationic oligopeptide 1 efficiently binds to double-stranded DNA,

24 The eight-residue alanine oligopeptide Ac-A(4)KA(2)Y-NH(2) (AKY8) was found to for

25 of the DeltadacA mutant we hypothesized that oligopeptides act as osmolytes, similar to glycine betai

26 The oligonucleotide-oligopeptide adducts are heat stable but are partially r

27 upon addition of LiCl to reduce polymer and oligopeptide aggregation.

28 with Michalis-Menten kinetic analyses of 21 oligopeptide aminomethyl-coumarin substrates.

29 e soft-landed kinases phosphorylated LRRASLG oligopeptide and D-fructose, respectively.

30 pA, two periplasmic binding proteins for the oligopeptide and dipeptide transport systems.

31 duced proteolytic activities in Tsh-specific oligopeptide and mucin cleavage assays.

32 their possession of a higher total amount of oligopeptides and a lower ratio of vicilin to 21kDa coco

33 s off tripeptides from the free N termini of oligopeptides and also shows minor endopeptidase activit

34 ulated molecular structures of the metalated oligopeptides and duplexes indicate that the peptide bac

35 s sense population density-specific secreted oligopeptides and modulate the expression of genes invol

36 For nonspecific binding of oligopeptides and other cationic ligands, including prot

37 that PIs altered the degradation patterns of oligopeptides and peptide production in a sequence-speci

38 ironments where AAs in combined forms (e.g., oligopeptides and proteins) are more abundant than free

39 from oligopeptides when proteases cleave the oligopeptides and release amino acids.

40 Bradyrhizobium japonicum transports oligopeptides and the heme precursor delta-aminolevulini

41 systems considered are a large DNA fragment, oligopeptides, and even entire proteins in an implicit s

42 er identical conditions, XGo produced larger oligopeptides, and XGh produced smaller peptides, as evi

43 Remarkably, similar oligopeptides are also found in N-terminal tails of huma

44 A single amino acid and various oligopeptides are grafted with yields up to 60% after a

45 Oligopeptides are important markers of protein metabolis

46 se inhibitors (PIs) and structurally related oligopeptides are known to reversibly bind and inactivat

47 Oligopeptides are robust substrates for the selective re

48 develop a neonicotinoid biosensor, these two oligopeptides are synthesized and immobilized on the sur

49 In this study, oligopeptide arrays were used to screen substrates direc

50 ce for alpha-helix formation of a 10-alanine oligopeptide as a function of its position within the tr

51 ce enzyme-labeled antibodies, we use a short oligopeptide as an hCG receptor to bind hCG.

52 ng flavourzyme which was mainly consisted of oligopeptides as the main fraction as well as small frac

53 ripeptides, mimosine-FFY, and short-sequence oligopeptides at inhibiting mushroom tyrosinase.

54 P) is a large 80 kDa protease, which cleaves oligopeptides at the C-terminal side of proline residues

55 RapJ in complex with the centrally important oligopeptide autoinducer competence and sporulation fact

56 PrgX proteins that are regulated by imported oligopeptide autoinducers.

57 Each assay consisted of a cleavable oligopeptide, based on the natural substrate sequence, l

58 ead-to-tail cyclodimerization of resin-bound oligopeptides bearing azide and alkyne groups occurs rea

59 Oligopeptides bearing internal diacetylene units are sho

60 so shown that protein substrates, GroES, and oligopeptides bind to partially overlapped sites on the

61 ight-binding oligosaccharide/oligonucleotide/oligopeptide binding (OB)-fold.

62 Of these, a transcript encoding a putative oligopeptide binding protein (OppA) was further characte

63 The mutations, mostly in the oligopeptide binding protein located on the cell surface

64 d oligopeptide permease protein A (OppA), an oligopeptide binding protein of an apparent oligopeptide

65 We conclude that the oppA genes encode oligopeptide binding proteins, possibly displaying diffe

66 g-law polyelectrolyte theory for +4 cationic oligopeptides binding to single-stranded nucleic acids.

67 ce of an OB (oligonucleotide/oligosaccharide/oligopeptide) binding motif to recognize single-stranded

68 er surface lipoprotein OspA, the periplasmic oligopeptide-binding lipoprotein OppAIV and mRFP1, a mon

69 Comparison of PrgZ with homologous oligopeptide-binding proteins (AppA and OppA) explains t

70 ins in addition to dentilisin, most notably, oligopeptide-binding proteins (OBPs) and the beta-barrel

71 By contrast, oligopeptide-binding proteins bind their ligands through

72 nding protein (tm0031) that is homologous to oligopeptide-binding proteins.

73 at are sensitive to inhibition; and putative oligopeptide-binding sites on the inhibited proteins.

74 zeta (PKC-zeta) inhibitor (a pseudosubstrate oligopeptide), but not a PKC-alphabeta inhibitor, signif

75 hemically crosslinked to cysteine-containing oligopeptides by low doses of UVA.

76 This oligopeptide can be cleaved by alpha-chymotrypsin at mul

77 he VCD signal intensities of amino acids and oligopeptides can be enhanced by up to 2 orders of magni

78 ilized on a solid surface, its long flexible oligopeptide chain is able to influence the orientation

79 ydration condensation of amino acids forming oligopeptide chains in around 50% yield.

80 trace element chromium is believed to be the oligopeptide chromodulin.

81 The ATS-9R/shFABP4 oligopeptide complex could prove to be a safe therapeuti

82 his culture filtrate was identified to be an oligopeptide composed of 11 amino acids.

83 cleotide template designed to produce random oligopeptides composed of 2-16 amino acids, and high-thr

84 olysis of cross-linked proteins into smaller oligopeptides constitutes an initial step in removal of

85 An end-linked oligopeptide containing one or more cysteines promoted P

86 ding of Fab 1A5 to DENV-2 was competed by an oligopeptide containing the fusion peptide sequence as s

87 ific AQP4 binding of a fluorescently labeled oligopeptide containing the putative adhesion sequence i

88 A 22-amino acid oligopeptide containing this sequence (MRPFL) was shown

89 is for GLUT4 inhibition, a family of related oligopeptides containing structural elements found in PI

90 Oligopeptides containing the same amino acid substitutio

91 caques consistently reacted with overlapping oligopeptides corresponding to a region located within t

92 ic parameters determined for the cleavage of oligopeptides corresponding to the cleavage sites in r-p

93 en cellular receptors and synthetic adhesion oligopeptides coupled to an artificial extracellular mat

94 ons form interstrand cross-links between two oligopeptides, creating duplex structures linked exclusi

95 is not known whether the combined repetitive oligopeptide (CROP) domain is involved in or required fo

96 epitopes within the TcdB combined repetitive oligopeptide (CROP) domain, preventing toxin binding to

97 least in part via their combined repetitive oligopeptide (CROP) domains.

98 y a C-terminal domain of combined repetitive oligopeptides (CROP).

99 s on the TcdA C-terminal combined repetitive oligopeptides (CROPs) domain.

100 However, 4- and 12-aa-long oligopeptides crosslinked to the DNA backbone were recog

101 Multiple copies of a short oligopeptide derived from a minimal transactivation doma

102 istocompatibility complex (MHC) that present oligopeptides derived from aberrant self or foreign prot

103 ad specificity of the Mtb proteasome towards oligopeptides described in the companion article.

104 This oligopeptide did not interfere significantly with viral

105 ANXA1-based oligopeptides displayed the same effects as ANXA1 on NF-

106 of recognition and repair of protein-DNA and oligopeptide-DNA crosslinks by the human excision nuclea

107 '2A' oligopeptides drive one such event, termed 'stop-carry o

108 ammetry of the Fe(2+)- and Cu(2+)-linked bpy oligopeptide duplexes shows that they possess unique ele

109 An oligopeptide, E peptide, within the cytoplasmic segment

110 gnificantly modulated the photoreactivity of oligopeptides either through altering the accessibility

111 d involved transforming the pathogen with an oligopeptide-encoding plasmid library, constructed using

112 The oligopeptide epitope tags allow the affinity purificatio

113 of Cid is characterized by subgroup-specific oligopeptide expansions.

114 -aminoisobutyric acid (Aib) in alanine-based oligopeptides favors the formation of a 3(10) helix when

115 The aqueous self-assembly of oligopeptide-flanked pi-conjugated molecules into discre

116 arding the de novo design of self-assembling oligopeptides for biomedical and biotechnological applic

117 he development of cocoa aroma, however cocoa oligopeptide fraction is under-investigated.

118 In contrast, when the shorter oligopeptide fragments are immobilized on the same surfa

119 Isolated oligopeptide fragments containing this epitope act as fu

120 nd determines the prevalent folding of small oligopeptides (from di- to tetramers) composed of 2-amin

121 This oligopeptide functionalized SPR biosensor also shows goo

122 This oligopeptide functionalized SPR biosensor can rapidly de

123 The sensitivity of this oligopeptide-functionalized SPR biosensor is 1.02 RU/muM

124 n of the corresponding gene, proved that the oligopeptide functioned as an autoregulatory molecule re

125 , we show that an adipocyte-targeting fusion-oligopeptide gene carrier consisting of an adipocyte-tar

126 molecules are derived mainly from cytosolic oligopeptides generated by proteasomes during the degrad

127 rile necrosis relies on proteasome-dependent oligopeptide generation and functional status of peptida

128 The present SAR of those CXCL12-oligopeptide grafts reveals the key determinants involve

129 Long oligopeptides (>10 residues) are generated during the ca

130 crystallographic coordinates of LacY and the oligopeptide/H(+) symporter.

131 nitrogen in the form of free amino acids and oligopeptides has received increasing attention over the

132 Two oligopeptides, hepta-histidine (7H) and Angiotensin III,

133 his study, loss of function mutations in the oligopeptide importer (oppABCDF) and glycine betaine imp

134 a library of clones expressing intracellular oligopeptides in order to identify inhibitors of protein

135 the sorption-enhanced phototransformation of oligopeptides in solutions containing chromophoric disso

136 form a deep investigation of the presence of oligopeptides in unfermented, under fermented, and well-

137 20 nM were obtained for biologically active oligopeptides in water.

138 ensity for self-association in comparison to oligopeptides; insights into the structure and dynamical

139 t model for the catabolism of globin-derived oligopeptides invokes peptide transport out of the food

140 tion of a 3(10) helix when the length of the oligopeptide is about four to six residues.

141 Finally, conjugation of the glycan to PSMA oligopeptide is described.

142 The 2A oligopeptide is emerging as a highly effective new tool

143 When the original oligopeptide is immobilized on a solid surface, its long

144 l differential ln a(+/-)) for binding of the oligopeptide KWK6 (ZL = +8) to single-stranded (ss) dT(p

145 nding density) for the +8-charged C-amidated oligopeptide KWK6 and short single-stranded DNA oligonuc

146 ons for any protein that recognizes specific oligopeptide ligands.

147 ented proteolysis of hemoglobin (Hb)-derived oligopeptides, likely starving the parasite resulting in

148 The oligopeptide linkages used were those of the idealized p

149 IgE-binding epitopes were identified by oligopeptide microarray.

150 used for grafting poly(ethylene glycol) and oligopeptide moieties by the Cu(I)-catalyzed addition of

151 In order to diversify the structure of the oligopeptide moiety of the muraymycins for thorough stru

152 This one-pot protocol utilizes an oligopeptide multicatalyst, m-CPBA as the oxidant, and N

153 Of the oligopeptide mutants, only the oppB strain differed sign

154 Formation of aligned synthetic oligopeptide nanostructures is accomplished using planar

155 pen-gate Mtb mutant 750 kDa particle cleaved oligopeptides not only after hydrophobic residues but al

156 proteolytic digestion of hemoglobin to short oligopeptides occurs in an acidic organelle called the f

157 by ROMP and be of general use with norbornyl oligopeptides of any sequence.

158 ed competition experiments using synthesized oligopeptides of the transit peptide of ferredoxin precu

159 ansporter genes for dipeptide (dppABCDF) and oligopeptide (oppABCD) transport.

160 ons in AtOPT3, which encodes a member of the oligopeptide (OPT) family of peptide transporters, and a

161 The oligopeptide permease (opp) ABC transport system is a nu

162 The B. burgdorferi oligopeptide permease (Opp) is one of only a few transpo

163 We analyzed expression of a putative oligopeptide permease (Opp) of Borrelia burgdorferi.

164 orthologues of the substrate binding protein oligopeptide permease A (OppA).

165 ons is one of the five annotated homologs of oligopeptide permease A (OppA5, BBA34).

166 M. catarrhalis has a putative oligopeptide permease ABC transport operon (opp) consist

167 xpression is polycistronic with the upstream oligopeptide permease genes (opp1ABCDF), which encode an

168 ing approach for vaccine antigens identified oligopeptide permease protein A (OppA), an oligopeptide

169 The Bacillus subtilis oligopeptide permease stimulates competence development

170 hed transformability, as did deletion of the oligopeptide permease subunit oppD, suggesting that XIP

171 encodes an arginine deiminase pathway and an oligopeptide permease system that could contribute to gr

172 The opp operon, which encodes an oligopeptide permease that is essential for sporulation

173 ly controlled by ScoC and encodes a putative oligopeptide permease, was activated indirectly by CodY

174 ntracellular receptor, ComR, after uptake by oligopeptide permease.

175 large mechanosensitive channel, or Opp, the oligopeptide permease.

176 e family, a dipeptide permease (Dpp) and two oligopeptide permeases (Opp and App) with overlapping sp

177 Bacterial oligopeptide permeases are members of the large family o

178 Oligopeptide permeases are needed for bacteria to utiliz

179 e, we investigated the role of two conserved oligopeptide permeases, Opp and App, in the regulation o

180 for the synthesis and modification of novel oligopeptide-pharmacophore conjugates by C-H functionali

181 owires prepared from perylene bisimides with oligopeptide-polymer side chains.

182 ngth (n = 25-50) of high-substituent-density oligopeptide polymers synthesized by ROMP is dramaticall

183 l immunosurveillance is based on recognizing oligopeptides presented by MHC class I molecules.

184 Many of the oligopeptides produced by this process are too long to s

185 ereas SC PEP rapidly detoxifies the residual oligopeptide products of EP-B2 digestion.

186 ture has been determined in complex with the oligopeptide, protease-inhibitor antipain, giving detail

187 s: generation and secretion of the signaling oligopeptides, re-internalization of the signaling molec

188 obvious importance, the mechanistic basis of oligopeptide receptor regulation is largely unknown.

189 ge of a chimeric protein system to study the oligopeptide repeat domain (ORD) expansions of the prion

190 cleation and fiber growth, while an adjacent oligopeptide repeat domain is largely dispensable for pr

191 y amino acid composition, the nucleation and oligopeptide repeat domains of Sup35 have distinct compo

192 Suppression required the oligopeptide repeat of the Sup35N prion domain, which is

193 Expansion of the oligopeptide repeats (ORE) found in PrP is associated wi

194 ced conformational differences in one of the oligopeptide repeats (R2) in the N terminus of Sup35 and

195 Oligopeptide repeats appear in many proteins that underg

196 Second, oligopeptide repeats are found in multiple prion protein

197 the Sup35p prion domain, and that the Sup35p oligopeptide repeats are not required for prion maintena

198 ide a general model for studying the role of oligopeptide repeats in prion conformational conversion

199 ne/asparagine rich regions and the number of oligopeptide repeats in the prion domain.

200 Here we show that the five oligopeptide repeats present at the N-terminus of Sup35p

201 t, the position and context of an individual oligopeptide segment within the HVR were significant det

202 on both the number of l-alanine units in the oligopeptide segments and length of the alkylene spacer

203 collagen structure using a relatively simple oligopeptide sequence establishes new opportunities for

204 The short oligopeptide sequence, (N-)PPLRINRHILTR(-C), is identifi

205 h to annotate metagenomes using unique k-mer oligopeptide sequences from 7 to 12 amino acids long.

206 y library, we identified two highly specific oligopeptide sequences RKRIRRMMPRPS and RNRHTHLRTRPR for

207 Other oligopeptides showed weaker or no inhibitory activity.

208 This oligopeptide shows high binding specificity for glyphosa

209 m the chlorination of AAs in combined forms (oligopeptides) significantly exhibited a different patte

210 OpdB may be accessible only to unstructured oligopeptides, similar to the closely related prolyl oli

211 H derivatives were readily incorporated into oligopeptides site-specifically using standard solid-pha

212 cleavage of glycylphenylalanylleucylglycine oligopeptide spacer, used as GA derivative copolymer att

213 f the reaction using glutathione (GSH) as an oligopeptide stopper, we have employed cytochrome C (Cyt

214 the alkylene spacer between chromophore and oligopeptide substituents.

215 In this assay, an oligopeptide substrate (CLSELDDRADALQAGASQFESSAAKLKRKYWW

216 tical to their preferences displayed against oligopeptide substrates, indicating that GS-7340 and oth

217 In addition to oligopeptide substrates, restricted proteolysis of histo

218 the cyanobacteria produce protease inhibitor oligopeptides such as cyanopeptolins and cause drinking

219 Crosslinking occurs via oligopeptide sulphydryl and free amino groups.

220 ligation, presumably derived primarily from oligopeptide-supplied carboxylate groups.

221 Oligopeptide synthesis is enhanced when a commonly used

222 An application to oligopeptide synthesis was illustrated.

223 mino acids are imported as such or as di- or oligopeptides that are subsequently degraded in the cyto

224 high-throughput genetic system for producing oligopeptides that can be used to identify molecular int

225 Bioactive peptides are oligopeptides that consist of 2-20 amino acids that can

226 demonstrate that exceptional class I binding oligopeptides that escape proteolytic degradation are po

227 relationship (QSAR) model is established for oligopeptides that inhibit angiotensin I-converting enzy

228 Using this method we were able to identify oligopeptides that inhibit virulence and/or drug resista

229 We screened an internal library for oligopeptides that inhibited both mushroom and human tyr

230 d using protamine and synthetic polycationic oligopeptides that possess specific cleavage sites that

231 e of carbonyl-containing pharmacophores onto oligopeptides, thus providing a chemical tool for the sy

232 -strand conformation when incorporated in an oligopeptide ("@-tide") strand.

233 eloped to use the arginine-glycine-aspartate oligopeptide to target angiogenesis and to use bombesin

234 s and not an absolute inability of cytosolic oligopeptides to be transferred to and presented by prof

235 residues promoted sorption of His-containing oligopeptides to CDOM macromolecules through electrostat

236 in proteolysis, transport, and catabolism of oligopeptides to obtain amino acids in this protein-rich

237 Transpeptidases cross-link peptidoglycan oligopeptides to provide vital cell wall rigidity and st

238 ns are transferred onto corresponding larger oligopeptides to simulate the spectra for dodecamers.

239 of the sensing element is decorated with an oligopeptide, TPFDLRPSSDTR, which is identified by using

240 This supports the contention that oligopeptide transport may have an impact on the extrace

241 s the substrate-binding component of a novel oligopeptide transport system (encoded by lmo0135) was r

242 ctive import into bacterial cells through an oligopeptide transport system.

243 oligopeptide binding protein of an apparent oligopeptide transport system.

244 homologs for PrtP and PrtM, and two complete oligopeptide transport systems.

245 condary cell wall biogenesis, cell cycle and oligopeptide transport were mainly downregulated.

246 Genes involved in flagellar biosynthesis, oligopeptide transport, amino acid import and metabolism

247 eration appears to change the specificity of oligopeptide transport.

248 arately, and that both genes are involved in oligopeptide transport.

249 e Arabidopsis thaliana AtOPT3 belongs to the oligopeptide transporter (OPT) family, a relatively poor

250 We have identified nine oligopeptide transporter (OPT) orthologs (AtOPT1 to AtOP

251 The human intestinal oligopeptide transporter (PEPT1) facilitates the absorpt

252 The proton-coupled oligopeptide transporter (POT) YdgR from Escherichia col

253 A sodium-coupled oligopeptide transporter (SOPT1) was described originall

254 al epithelial cells have identified a second oligopeptide transporter (SOPT2).

255 The oligopeptide transporter 1, PepT1, is a member of the Sl

256 he YSL1 and YSL3 proteins are members of the oligopeptide transporter family and are predicted to be

257 resent evidence that AtOPT3, a member of the oligopeptide transporter gene family with significant si

258 ic carbohydrates, and in some cases putative oligopeptide transporter genes were also found to respon

259 The human intestinal proton-coupled oligopeptide transporter hPEPT1 has been implicated in t

260 We report here that an Arabidopsis oligopeptide transporter mutant, opt3-2, over-accumulate

261 ent reciprocal relationship between the H(+)/oligopeptide transporter PepT1 and apical GLUT2, reflect

262 The oligopeptide transporter PepT1 expressed in inflamed col

263 Both are substrates for the proton-coupled oligopeptide transporter PEPT2.

264 fetal RPE cells express the newly discovered oligopeptide transporter SOPT2, and the transporter is i

265 was coincidentally expressed with OPT-2, an oligopeptide transporter that is driven by a transmembra

266 eport that OPT3, previously classified as an oligopeptide transporter, is a plasma membrane transport

267 Qsp1 sensing requires an oligopeptide transporter, Opt1, and remarkably, cytoplas

268 PepT2, which belong to the proton-dependent oligopeptide transporter, or POT family.

269 An oligopeptide transporter, PepT1, is transcriptionally up

270 rg; L-KTP) administration in mice lacking an oligopeptide transporter, PEPT2.

271 mease genes (opp1ABCDF), which encode an ABC oligopeptide transporter.

272 for their affinity for hPEPT1, an intestinal oligopeptide transporter.

273 Proton-coupled oligopeptide transporters (POTs) couple the inward trans

274 tered the hfRPE cells via the sodium-coupled oligopeptide transporters 1 and 2 (SOPT1, SOPT2).

275 BC transport systems originally annotated as oligopeptide transporters as candidate transporters for

276 The presence of multiple oligopeptide transporters in brain has generated conside

277 nsceptor CHL1/NRT1.1/NPF6.3 and four related oligopeptide transporters PTR1, 2, 4, and 5 into fluores

278 The oligopeptide transporters SOPT1 and SOPT2 mediate the up

279 Genes encoding putative oligopeptide transporters were often coregulated with ad

280 PA3934, which belongs to the family of small oligopeptide transporters; and PA5152-5155, which encode

281 ycopeptide dendrimers composed of a branched oligopeptide tree structure appended with glycosidic gro

282 Glycine oligopeptides up to 20 amino acids long were formed with

283 f the 750 kDa particle towards a hydrophobic oligopeptide was nearly two orders of magnitude less tha

284 Coiled-coil formation of four different oligopeptides was characterized in solution, on hydrogel

285 um(II)-catalyzed C(sp(3) )-H alkynylation of oligopeptides was developed with tetrabutylammonium acet

286 The cleavage profile of oligopeptides was found to be unique for each SPATE prot

287 However antibody to HVR oligopeptides was not consistently maintained during per

288 ng established the formation of glycine homo-oligopeptides, we then demonstrated the co-condensation

289 Oligopeptides were determined by UPLC/ESI-MS and 35 low-

290 he pKa values of His residues in the studied oligopeptides were found to be between 4.3 and 8.1.

291 rmation rate constants of the His-containing oligopeptides were highly pH-dependent in an environment

292 nt conserved flanking domains, and these HVR oligopeptides were most immunogenic at the time of acute

293 Since oligopeptides were sufficient to inhibit growth of the D

294 tect protease by separating amino acids from oligopeptides when proteases cleave the oligopeptides an

295 apo-TraR was rapidly degraded by trypsin to oligopeptides, whereas TraR-AAI complexes were more resi

296 PR gold sensor chip is modified by using the oligopeptide with a surface density of 0.6 1/nm(2).

297 In this study, AYSSGAPPMPPF (PEPAu), an oligopeptide with an affinity for gold surfaces, was mod

298 A series of oligopeptides with beta-forming and adhesive properties,

299 ational equilibria of the proline-based host oligopeptides with single guests.

300 promote hydrolysis of natural and synthetic oligopeptides with unprecedented regioselectivity; the o