ライフサイエンスコーパス: COOH

1 COOH-MWCNTs generated singlet oxygen ((1)O2) and hydroxy

2 io of product ions resulting from either R(1)COOH or R(2)COOH neutral losses is dependent on the natu

3 mputations demonstrate that oxalic acid [1, (COOH)2] exhibits a sequential quantum mechanical tunneli

4 ed peptide (NH(2)-(111)RVREYEKQLEKIKNMI(126)-COOH) that facilitates PKCdelta binding to dF(1)F(0).

5 Garcinoic acid (GA or delta-T3-13'COOH), is a natural vitamin E metabolite that has prelim

6 ompositions, the best fit results for the 16 COOH-SAM thickness and surface roughness on the AuNPs in

7 For the 16 COOH-SAMs on flat Au surfaces, using a SAM thickness of

8 erived peptide (NH(2)-(2)AGRKLALKTIDWVSF(16)-COOH) that inhibits PKCdelta binding to dF(1)F(0) in ove

9 is species and the analogous carbamic (NH(2) COOH) and carbonic acids (H(2) CO(3) ).

10 ion to form phosphine carboxylic acid (PH(2) COOH) and functionalization to form esters is shown to i

11 prodrug, c,t,c-[Pt(NH(3))(2)(O(2)CCH(2)CH(2)COOH)(OH)Cl(2)] [PLA-Pt(IV)].

12 t ions resulting from either R(1)COOH or R(2)COOH neutral losses is dependent on the nature of the ph

13 tin, whereas the ACD truncated on the NH(2), COOH or both ends did not exhibit such actin cross-linki

14 the order -NH(2) ~ -N(+)(CH(3))(3) > -NH(2)/-COOH > -H(2)PO(3) ~ -OH > -COOH > -CH(3).

15 sses the formin homology 1-formin homology 2-COOH region of the protein.

16 xycarbonate (NaHCO(3)) and acetic acid (CH(3)COOH), the hypergolic explosion produced via merging a d

17 -MHA), 11-mercaptoundecane(ethylene glycol)3-COOH (PEG), 3-MPA-LHDLHD-OH, and 3-MPA-HHHDD-OH.

18 (CH(3))(3))(2)-2,2'-bipyridine, dcb is 4,4'-(COOH)(2)-2,2'-bipyridine, and dnb is 4,4'-(CH(3)(CH(2))(

19 (2+) (bpy is 2,2'-bipyridyl and dcb is 4,4'-(COOH)2-2,2'-bipyridyl).

20 with NH(2) (2), NMe(2) (3), OH (4), OMe (5), COOH (6), and COOMe (7), and benzophenone-3,3',4,4'-tetr

21 ence of cholesterol: 57.70 muM for Modelin-5-COOH and 35.64 muM for Modelin-5-CONH(2) compared to the

22 c acid (Ipa) anchor group to form Z-(Aib)(6)-COOH or Z-(Aib)(6)-Ipa, respectively.

23 compounds, including 8-hydroxy, 8-oxo, and 8-COOH-linalool, as well as lilac aldehydes and alcohols.

24 ated to ribosome-inactivating proteins and a COOH-terminal domain, which displays similarity to eukar

25 l domain, two separate kinase domains, and a COOH-terminal domain.

26 Proton transfer from a COOH group (DeltaG(double dagger) = 8.36 kcal/mol) or th

27 rvasive changes occur upon conversion from a COOH to a CH(2)OH substituent at C6 than from COOH ioniz

28 arkedly reduced by the catalytic action of a COOH functionality acting as a donor-acceptor group affe

29 ent to a self-assembled monolayer (SAM) of a COOH-terminated alkanethiol.

30 In the same model system, we show that a COOH-terminal truncation mutant of ING4 found in human c

31 ical shifts, and some J-couplings, yielded a COOH pK(a) of 3.0 +/- 0.1 in both anomers.

32 e their properties: (a) the attachment of a -COOH function to the ferrocene fragment leads to the imp

33 ivity due to the presence of a 37 amino acid COOH-terminal region and that this region is capable of

34 unctional group addition is carboxylic acid (COOH) approximately hydroxyl (OH) > nitrate (ONO2) > car

35 n Wnt proteins to activated carboxylic acid (COOH) or glutaraldehyde (COH) groups functionalized on s

36 HCC tumors, whereas natural carboxylic acid (COOH)-truncated HBx was found in the remaining 23 (46%)

37 to the structural contribution of the acidic COOH-terminal region of factor Va heavy chain to factor

38 gene and synthesis of constitutively active COOH-terminally truncated AR variants lacking the AR lig

39 he delta-COOH, an acetol ester for the alpha-COOH, and a tert-butyldimethylsilyl ether for the gamma-

40 tructure of L-ASP exists in an unusual alpha-COOH protonation state.

41 al activity was the cationic and amphipathic COOH-terminus.

42 such as OH, NH(2), CH(2)OH, CH(2)NH(2), and COOH, the present study extends the investigation to ort

43 oprotein (DSPP) is processed into NH(2)- and COOH-terminal fragments, but its key cleavage site has n

44 he cysteine, proteolytic removal of aaX, and COOH-terminal methylation.

45 oton migrations from N-terminal ammonium and COOH groups to the C-2' position of the reduced His ring

46 sphorylation of the juxtamembrane domain and COOH-terminal docking site of c-Met, and its downstream

47 its NH(2)-terminal actin-binding domain and COOH-terminal EF-hand-GAS2 domain.

48 erivatives I-IV, of which COOH-NH(2) (I) and COOH-NHMe (IV) are endowed with acid and base bifunction

49 uction of IgG Abs that recognize both N- and COOH-terminal epitopes of the human Dsg3 ectodomain.

50 udies are the first to show that the NH2 and COOH termini of sMyBP-C have distinct functions, which a

51 dditional PAM residues placed at the NH2 and COOH termini of VEK30.

52 ontaining unique segments within the NH2 and COOH termini.

53 ations in their long, unstructured, NH2- and COOH-terminal tails.

54 unctionalized AFM cantilevers and the OH and COOH SAM surfaces were predominantly 'loop-like' (76% an

55 Direct spectroscopic evidence for OH* and COOH* species forming on Pt(100) and Pt(111) surfaces wa

56 ary, the formation and adsorption of OH* and COOH* species plays a vital role in expediting the elect

57 d formation between amino groups of PANI and COOH groups of anti-Cab.

58 J(H4,H5), are unaffected by solution pD, and COOH ionization exerts little effect on J(CH) and J(CC)

59 eted in liver cancer 1 (DLC1) by tensin3 and COOH-terminal tensin-like protein (cten) controls EGF-dr

60 y exists as the processed NH(2)-terminal and COOH-terminal fragments in the extracellular matrix of t

61 on, is processed into the NH(2)-terminal and COOH-terminal fragments.

62 to the culture medium by SubA treatment, and COOH-terminal domain signal transduction is abrogated, w

63 se mutations in the NH2 terminus (W236R) and COOH terminus (Y856H) of sMyBP-C have been causally link

64 other than thiols such as -OH, -NH(2), and -COOH.

65 te structural moieties (e.g., -NH(3)(+) and -COOH) and distinct interaction mechanisms (e.g., cation

66 labile atoms (those from -OH, -NH, =O, and -COOH groups) can be predicted from SMILES patterns and s

67 groups at the substrate surface (--OH and --COOH) may also contribute.

68 tion of the reduction intermediates, such as COOH*, and the formation of CO.

69 Au-COOH decomposition involves proton transfer to water and

70 Moreover, Au-NR3+ NPs, but not the Au-COOH NPs, were found to trigger dose-dependent lethality

71 dily reacts with adsorbed Au-CO, yielding Au-COOH.

72 ve and reveals the rate-limiting step to be *COOH to *CO at low overpotentials, CO[Formula: see text]

73 e S-transferase chimera of the cargo-binding COOH tail (CT) of MyoVa binds Rab8A and the related Rab1

74 ngineered SK mutant fusion protein with both COOH- and NH(2)-terminal His(6) tags.

75 Microcephalin (MCPH1) is a BRCA1 COOH terminal (BRCT) domain containing protein involved

76 whereas activation of the MMP10 promoter by COOH-truncated HBx was abolished when the activator prot

77 oxy-p-benzoquinone, or benzene decorated by -COOH groups exhibit ordered magnetic moments, leading to

78 surface acidity of carbon dots imparted by -COOH functionality could effectively catalyze the format

79 adecanoic acid self-assembled monolayer (C16 COOH-SAM) layer thickness on gold nanoparticles (AuNPs)

80 XPS measurements of C16 COOH-SAMs on flat gold surfaces were made at nine differ

81 drocarbon-contamination layer on top the C16 COOH-SAM was necessary to improve the agreement between

82 he percentage of carbonyl (CO) and carboxyl (COOH) groups in oxidized starches also increased with th

83 agnesium oxide (size<10nm) grafted carboxyl (COOH) functionalized multi-walled carbon nanotubes (nMgO

84 the premanent presence of surface carboxyl (-COOH) groups from MAA segments of the copolymer which ca

85 0 = 180 nm) with amino (-NH2), carboxylate (-COOH), phosphate (-PO3H2) or sulfonate (-SO3H) groups af

86 Carboxylated (COOH) and aminated (NH2) polystyrene microspheres were d

87 Carboxylic (COOH), carbonyl (C=O), and hydroxyl (OH) groups were enu

88 x10(-10) cm(3) s(-1) and k((CH3 )2 COO + CF3 COOH)=(6.1+/-0.2)x10(-10) cm(3) s(-1) at 294 K exceed es

89 The rate coefficients k(CH2 OO + CF3 COOH)=(3.4+/-0.3)x10(-10) cm(3) s(-1) and k((CH3 )2 COO

90 ds, formic acid (HCOOH) and acetic acid (CH3 COOH), employing two complementary techniques: multiplex

91 rface passivation layer of zinc oxide in CH3 COOH/H2 O and subsequent self-exchange of Zn and Zn(2+)

92 ity associated with the Zn metal and the CH3 COOH/H2 O solution is critically important, as revealed

93 terized by a long, highly positively charged COOH-terminal region, absent in most other chemokines.

94 trong preference for the trans- over the cis-COOH configuration.

95 ere primarily found in the highly conserved, COOH-terminal pore-region domain.

96 These proteins undergo three coordinated COOH-terminal events: isoprenylation of the cysteine, pr

97 peptide, Ac-Arg-Ala-[d-Cys-Arg-Phe-Phe-Cys]-COOH (3).

98 placed as an extra stretch in the cytosolic COOH-terminal region, contributed per se to cold adaptat

99 (D-OH) and carboxyl-terminated 'anionic' (D-COOH) Polyamidoamine (PAMAM) dendrimers were absorbed by

100 for Nalpha, a tert-butyl ester for the delta-COOH, an acetol ester for the alpha-COOH, and a tert-but

101 lefinic monocarboxylic acids with CO-derived COOH groups undergoing subsequent stepwise hydrogenation

102 al natural leukocyte- and fibroblast-derived COOH-terminally truncated CXCL9 forms missing up to 30 a

103 (delta-) to form COOH* and then dissociating COOH* to form *CO are 0.37 eV and 0.30 eV, respectively.

104 ring mutations depriving NKCC2 of its distal COOH-terminal tail and interfering with the (1081)LLV(10

105 Since the degree of ionization of the edge -COOH groups is affected by pH, GO's amphiphilicity can b

106 By tuning the ratio between EDOT and EDOT-COOH monomer, the nanofibrous structure and carboxylic a

107 ontrolled co-polymerisation of EDOT and EDOT-COOH monomers, using tetrabutylammonium perchlorate as a

108 that target co-chaperone binding to the EEVD-COOH motif that terminates Hsp70/Hsp90.

109 olium hexafluorophosphate for more efficient COOH* stabilization exhibit even higher reaction activit

110 cules arranged 'end-on' on OH and especially COOH SAMs; and initial 'side-on' contact, followed by ei

111 that substituents proximal to the exocyclic COOH group (i.e., the C4-O4 bond) influence the activati

112 and Slo1(QEERL), which differ at the extreme COOH terminus, show markedly different steady-state expr

113 de bonds between carboxylic groups of rGO-Fc(COOH)(2) and amine groups from enzyme.

114 Ran, wrapped by the conformational flexible COOH tail.

115 ), CH(3) (medC), CH(2)OH (hmdC), CHO (fmdC), COOH (cadC), F (FdC), or Br (BrdC)], fmdC and cadC exhib

116 barriers of protonating *CO2(delta-) to form COOH* and then dissociating COOH* to form *CO are 0.37 e

117 UVA irradiation removed carboxyl groups from COOH-MWCNT surface while creating other oxygen-containin

118 OOH to a CH(2)OH substituent at C6 than from COOH ionization within the uronides.

119 Further, COOH-NHMe (IV) showed a unique performance and was succe

120 metry showed that the response of the SPCE-G-COOH enhanced the sensitivity and precision, towards the

121 le modified screen-printed electrode (SPCE-G-COOH).

122 mediator and FDH, deposited onto the SPCE-G-COOH.

123 ly mediate aggregation and attachment (e.g., COOH, NH2, SH, CH3, OH) revealed signatures that reflect

124 howed capture efficiency better than FITC-G6-COOH-5aSlex conjugate.

125 all affinity binding value, KA, of the Au/GO-COOH chip can be significantly enhanced by up to approxi

126 he antigen-antibody interaction of the Au/GO-COOH chip cause this chip to become four times as sensit

127 a BSA concentration of 1mug/ml for an Au/GO-COOH chip, an Au/GO chip and a traditional SPR chip are

128 f carboxyl-functionalized graphene oxide (GO-COOH) composites to form biocompatible surfaces on sensi

129 and the amount of surface functional groups, COOH.

130 Conversely, GRP78 COOH-terminal domain ligation is pro-apoptotic and anti-

131 The predicted 28-kDa GRP78 COOH-terminal fragment is released into the culture medi

132 (3))(3) > -NH(2)/-COOH > -H(2)PO(3) ~ -OH > -COOH > -CH(3).

133 tion revealed by DFT computation was CO2 -->*COOH-->*CO-->*COCO-->*COCH2 OH-->*CH2 OCH2 OH-->CH3 CH2

134 dyl)pyrimidine-4-carboxylic acid; Cpp-NH-Hex-COOH = 6-(2-(pyridin-2-yl)pyrimidine-4-carboxamido)hexan

135 ) complexes, namely, [Ru(bipy)(2)(Cpp-NH-Hex-COOH)](2+) (2) and [Ru(dppz)(2)(CppH)](2+) (3) (bipy = 2

136 w potentials, reduction of a resulting Mn(I)-COOH complex at significantly more negative potentials i

137 rnate catalytic pathway-protonation of Mn(I)-COOH to form a cationic tetracarbonyl complex.

138 Without reduction of Mn(I)-COOH, catalysis occurs slowly via a alternate catalytic

139 ntermediate I is protonated to form a Fe(II)-COOH species.

140 l)-imidazoliumbromide, a carboxylated IL (IL-COOH), was used to immobilize anti-IgG to create an affi

141 tase (hDHFR) was chelated to the modified IL-COOH.

142 The IL-COOH demonstrated efficient detection of IgG in the nano

143 In addition, the IL-COOH demonstrated low fouling in crude serum, to a level

144 the SPR sensor, it was revealed that the IL-COOH SAM improved the activity of hDHFR by 24% in compar

145 The IL-COOH was further modified with N,N'-bis (carboxymethyl)-

146 Moreover, an intact COOH-terminal PDZ recognition motif (EAKL) in SR-BI is n

147 from the formation of adsorbed intermediate COOH* to be CO* desorption.

148 )(PO(3)H(2))(2)bpy)](2+) are converted into -COOH and H(3)PO(4).

149 ate expression levels of the intramembranous COOH-terminal fragment of cleaved PC1 required an intact

150 he rate-limiting step in each mechanism is **COOH formation at higher negative potentials.

151 and to a lesser extent multi-walled and its COOH-functionalized form induced CAF-like cells, which a

152 g during complex formation between SK or its COOH-terminal Lys(414) deletion mutant (SKDeltaK414) and

153 Shot binds along the microtubule through its COOH-terminal GAS2 domain and binds to actin with its NH

154 gating enzyme Ubc13 and the ubiquitin ligase COOH terminus of Hsp70 interacting protein (CHIP) as bei

155 is attributed to the strategically located -COOH which accelerates Schiff base formation.

156 nolayer end groups: NH(2) approximately OH < COOH < SH.

157 ere obtained for lipid distributions, making COOH-NHMe (IV) a potential next generation universal mat

158 ilica (-SiOH) or poly(methyl methacrylate) (-COOH) surfaces, AEX latex attachment is not stable over

159 disease is not clear due to loss of multiple COOH-terminal AR protein domains, including the canonica

160 xylated multi-walled carbon nanotubes (MWCNT-COOH), and oxalate decarboxylase enzyme (OxDc) immobiliz

161 ntly immobilized on the surface of the MWCNT-COOH modified glassy carbon electrode through amide link

162 on assembled carboxylated carbon nanotubes (COOH-CNTs) and poly-L-lysine (PLL) film was developed an

163 f carboxylated multiwalled carbon nanotubes (COOH-MWCNTs), an important environmental process affecti

164 thological analysis, the presence of natural COOH-truncated HBx significantly correlated with the pre

165 tives, featuring hydrophilic group (OH, NH2, COOH) at the para-position of the pendent 2-phenyl ring

166 several analyzed motifs present in the NKCC2 COOH terminus, only those required for ER exit and surfa

167 , this ortho-effect is observed for R = NO2, COOH, CHO, COOEt, COCH3, OCH3, and even CH3, but not for

168 that the presence of dispersed Fe(3)O(4)(np)-COOH does not affect the diffusion limiting currents was

169 solutions containing dispersed Fe(3)O(4)(np)-COOH, 8 and 17 nm in diameter, directly from the Levich

170 Desorption of Cd(2+) from Fe(3)O(4)(np)-COOH, as monitored by the same forced convection method,

171 etic iron oxide nanoparticles, Fe(3)O(4)(np)-COOH, was investigated in situ in aqueous electrolytes u

172 iencies of ~20 mug of Cd/mg of Fe(3)O(4)(np)-COOH, which are among the highest reported in the litera

173 ximated values depending on the abundance of COOH, C=O, and OH groups.

174 of glassy carbon electrodes: (i) creation of COOH groups, (ii) covalent immobilization of protein A w

175 surface potential and colloidal stability of COOH-MWCNTs, and are expected to reduce their mobility i

176 Our results demonstrate the superiority of COOH-NHMe (IV) in detecting more lipid and protein speci

177 role in the photochemical transformation of COOH-MWCNTs under UVA irradiation.

178 free energy difference for the formation of *COOH is lower than that with cobalt porphyrin, thus lead

179 200, ~ 1400, ~ 1500 ng cm(-2) for CH(3), OH, COOH and NH(2) SAMs) were consistent with: space-filling

180 full-length fibronectin (FN) on CH(3)-, OH-, COOH-, and NH(2)-terminated alkane-thiol self-assembled

181 reaction for Fib detection was performed on COOH-MBs or His-Tag-Isolation-MBs as solid support for t

182 and -SO3H-functionalized alumina but not on -COOH- and -PO3H2-functionalized particles.

183 otected rather than protected -OH, -NHR, or -COOH groups.

184 c functional groups such as -NH(2), -OH, or -COOH revealing the specificity for the detection of thio

185 d surfaces decreases in the following order: COOH > POx > NH(2).

186 ective carbene insertion into -NH bond over -COOH and -OH bonds leads to the wide range of carboxy an

187 A weak ion-exchange membrane (P-COOH) was synthesized by alkaline hydrolysis of a polyac

188 iously reported Au102(pMBA)44 (pMBA = -SPh-p-COOH); this is a surprise given the much bulkier naphtha

189 The lysozyme adsorption efficiency of the P-COOH membrane operating in a stirred cell contactor (Mil

190 The P-COOH membrane was characterized for its physical propert

191 minus of the polyprotein H(2)N-RLuc-P1-P2-P3-COOH (P1, structural domain; P2 and P3, nonstructural do

192 otein between P1 and P2 (N(2)H-P1-GLuc-P2-P3-COOH).

193 es with either carboxylic acid (anionic, P3T-COOH) or methylimidazolium (cationic, P3T-MIM) end group

194 In the case of P3T-COOH, the polymer shows a fully reversible phase transfe

195 boxylic acid functionalisation of Nano-PEDOT-COOH were varied over a fibre diameter range of 15.6 +/-

196 and carboxylic acid groups (i.e. Nano-PEDOT-COOH) via controlled co-polymerisation of EDOT and EDOT-

197 valently coupled QDs capped with bis(LA)-PEG-COOH to transferrin to facilitate intracellular uptake.

198 thiolated PEG encapsulation (SH-PEG, SH-PEG-COOH) denoted as AuNPs-SQ2-PEG and AuNPs-SQ5-PEG.

199 analogue, Ac-Arg-Ala-[d-Cys-Arg-Phe-His-Pen]-COOH (19), displayed subnanomolar affinity toward CXCR4,

200 f RNAs that bind the dipeptide NH(2)-His-Phe-COOH with K (D) ranging from 36 to 480 muM.

201 (+)-PIM-COOH was also synthesized by the acid hydrolysis of (+)-

202 haracterization, both (+)-PIM-CN and (+)-PIM-COOH were solvent cast directly into semipermeable membr

203 y, absorption of leuprolide into low MW PLGA-COOH particles yielded ~17 wt.% leuprolide loading in th

204 e loading in the polymer (i.e., ~70% of PLGA-COOH acids occupied), and the absorbed peptide was relea

205 ith either nontargeted PLGA-b-PEG-OH or PLGA-COOH.

206 We found that when the PLGA-COOH chains are sufficiently mobilized, therapeutic pept

207 orming a salt with low-molecular weight PLGA-COOH.

208 nsor array through the ensemble of CSD-PLNPs-COOH and certain MIs was developed and demonstrated aR-P

209 system (BioMEMS) were functionalized by Ppy-COOH/MNPs, using a chronoamperometric (CA) electrodeposi

210 ization was performed in order to ensure Ppy-COOH/MNPs electrodeposition on the microelectrode surfac

211 PS-COOH accumulated inside embryo's digestive tract while P

212 PS-COOH forms microaggregates (PDI > 0.4) in NSW, whereas P

213 1 gene resulted up-regulated at 48 hpf by PS-COOH whereas PS-NH2 induced cas8 gene at 24 hpf, suggest

214 rface charges where chosen, carboxylated (PS-COOH) and amine (PS-NH2) polystyrene, the latter being a

215 No embryotoxicity was observed for PS-COOH up to 50 mug mL(-1) whereas PS-NH2 caused severe de

216 (Si) and 100 nm carboxylated polystyrene (PS-COOH) NPs cloaked by human plasma HC were titrated with

217 pyrrole-co-pyrrole-2-carboxylic acid) (Py/Py-COOH) for high efficient detection of SPy.

218 ward, SA2-BSA was covalently bonded to Py/Py-COOH/MNP modified gold WEs through amide bonding.

219 pyrrole-co-pyrrole-2-carboxylic acid) (Py/Py-COOH/MNPs) cross-linked with Ab-TC, and the last one dir

220 tly through the functionalization with Py/Py-COOH/MNPs.

221 Rab11-GTP associates with the Rabin8 COOH-terminal region and is required for Rabin8 precilia

222 essing in vivo, as a result of which JIP60's COOH-terminal eIF4E domain is released and functions in

223 f the COOH-terminal region of CXCL9, several COOH-terminal peptides were chemically synthesized.

224 5 is modified with sulfenic acid on a single COOH-terminal cysteine (C581), and the level of sulfenic

225 The SK COOH-terminal Lys(414) residue and residues Arg253-Leu26

226 y small except for polar ortho-substituents (COOH, NO(2)).

227 ation reaction the concentration of surface -COOH groups can be carefully controlled.

228 Use of the optimum level of SWNT -COOH functionality allowed the construction of a prototy

229 almitic acid, whereas the analogous terminal COOH-containing OxPCs demonstrated a NL of 256.

230 n (Ubl) by adenylation of the Ubl C-terminal COOH group and then forms a thioester bond with the aden

231 hioester bond with the adenylated C-terminal COOH group of the Ubl.

232 shing a monolayer much more efficiently than COOH.

233 Our data suggest that COOH truncation of HBx, particularly with 24 amino acids

234 THC-COOH was rapidly removed from both deionized (DI) water

235 he analysis of THC, CBN, CBD, THC-OH and THC-COOH.

236 para position of the phenol structure of THC-COOH was confirmed by detection of monochlorinated bypro

237 r-9-carboxy-Delta9-tetrahydrocannabinol (THC-COOH) were shown to be strongly correlated to NH4-N.

238 9-carboxy-Delta(9)-tetrahydrocannabinol (THC-COOH) with chlorine.

239 9-carboxy-Delta(9)-tetrahydrocannabinol (THC-COOH), 11-hydroxy-Delta(9)-tetrahydrocannabinol (11-OH-T

240 ol (THC), 11-nor-9-carboxy-Delta(9)-THC (THC-COOH) and 11-hidroxy-Delta(9)-THC (THC-OH) in milk, live

241 [0.29-1.46]; p=0.0003) and lower urinary THC-COOH concentrations (mean 657.92 ng/mL [95% CI 381.60-11

242 nt) self-reported cannabis use and urine THC-COOH concentrations in the intention-to-treat population

243 The COOH-terminal domain of ZO-1 was required for its associ

244 The COOH-terminal fragment retained antibacterial activity w

245 The COOH-terminal peptide CXCL9(74-103) does not signal thro

246 The COOH-terminal region of the heavy chain contains acidic

247 e oxidized N-DNW electrode by activating the COOH group of N-DNW using ethyl(dimethylaminopropyl)carb

248 kinase domains, SK1 and SK2, present at the COOH terminus of giant obscurin-B.

249 tion, the presence of the VEDEC motif at the COOH terminus of Slo1 channels is sufficient to confer a

250 y a complete blockade of synergy between the COOH-terminal SAA1 fragments and CXCL8 or CCL3 in neutro

251 This conformational change exposes the COOH-terminal tail of Syk, which has three conserved Tyr

252 The measured acidities for the COOH and OH groups of coumaric and caffeic acids are 332

253 ith CyArg suggests an important role for the COOH group during catalysis.

254 Additional interactions from the COOH-terminal half of vWbp(1-474) strengthened the initi

255 ge of the nuclear localization signal in the COOH region of 2A to enhance its trafficking to the nucl

256 VEGF-Ax has a 22-amino-acid extension in the COOH terminus and has been reported to function as a neg

257 2 to induce phosphorylation of Ser375 in the COOH terminus of the receptor, to induce association of

258 l as a distinct conformational change in the COOH-proximal half of MRP1.

259 thermore, mutation of these tyrosines in the COOH-terminal region of Syk transforms it to an enzyme,

260 e truncated proteins, some of which lack the COOH-terminal catalytic domain.

261 o-Mmp-9, mutant pro-Mmp proteins lacking the COOH-terminal hemopexin domain fail to bind to Mmp-8(-/-

262 ectively, released distinct fragments of the COOH- and NH2 -terminal regions.

263 To investigate the role of the COOH-terminal region of CXCL9, several COOH-terminal pep

264 Deletion of the COOH-terminal SkzL Lys(415) residue reduces affinity for

265 Inducible stable expression of the COOH-truncated HBx protein (with 24 amino acids truncate

266 ch were truncated on either the NH(2) or the COOH terminal, as well as on both ends, were expressed f

267 The core structure of Ran, outside the COOH tail, is not altered by L(M) binding and remains ac

268 ation energy barrier through stabilizing the COOH* intermediates and tune the rate-limiting step from

269 inding and motility assays, we show that the COOH terminus mediates binding of sMyBP-C to thick filam

270 face GRP78 topology and demonstrate that the COOH-terminal domain is necessary for pro-apoptotic sign

271 Thus, the COOH-terminal hemopexin domains of pro-Mmp-8 and pro-Mmp

272 tivity and, notably, when transferred to the COOH terminus of a warm-adapted (rabbit) PEPT1, it confe

273 two conserved tyrosines located close to the COOH terminus of the protein-tyrosine kinase Syk.

274 e start of the nearby TnI helix 1 and to the COOH terminus of the TnT-TnI coiled-coil.

275 two PAM residues (Arg(126)-His(127)) to the COOH terminus of VEK30 (VEK32) maintained a monomeric pe

276 helices 1-6, including Loop 1) binds to the COOH-terminal portion (containing TM helices 7-8 and Loo

277 Furthermore, Pg binding to the COOH-terminal region of GRP78 stimulates cell proliferat

278 sisting of a short degron, CL1, fused to the COOH-terminus of green fluorescent protein (GFPu).

279 ch exhibited different reactivity toward the COOH-MWCNT surface.

280 ion that assists in H2 activation, while the COOH groups facilitate rapid proton movement.

281 parallel to the Cl covered surface, with the COOH plane perpendicular to the surface, as predicted by

282 4a/b, Ddb1, and Crbn, and interacts with the COOH terminus of the ACR via Crbn.

283 other members of the SLC12A family, of their COOH terminus.

284 ions removes the undesirable effect of these COOH groups almost completely.

285 domain, triggering EZH2 degradation through COOH terminus of Hsp70-interacting protein (CHIP)-mediat

286 ties for the interacting TnI helix 1 and TnC COOH-domain.

287 HDX of the TnI COOH terminus indicated that its known role in regulatio

288 Most of the TnI COOH terminus was protected from H/D exchange, implying

289 prid (positive pharmacophore) sorbed most to COOH-CNTs, indicating the importance of charge interacti

290 been described as a mechanism giving rise to COOH-terminally truncated, constitutively active AR isof

291 MLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes.

292 of nuclear import can be augmented by unique COOH-terminal sequences that reconstitute classical AR N

293 apoptotic signal transduction occurring upon COOH-terminal antibody ligation.

294 anthranilic acid derivatives I-IV, of which COOH-NH(2) (I) and COOH-NHMe (IV) are endowed with acid

295 n (CFL) was used as a fluorescent dye while -COOH functionalized multiwall carbon nanotubes (MWCNTs)

296 In comparison, PS NP coated with COOH (possessing negatively charged surfaces) in the siz

297 sules containing islets co-encapsulated with COOH-coated nanoparticles restore normal glycemia in imm

298 ) provided characteristic product ions, [R(x)COOH + Ag](+), and their neutral losses.

299 spholipids with unsaturated fatty acids (R(x)COOH, x = 1 or 2) provided characteristic product ions,

300 ional poly(ethylene glycols) (PEG(6)-Y, Y = -COOH and -NH(2)) represent unique surface-passivating li